Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6358.t1
Gene name
Locationscaffold_039:113498..115042
Strand-
Gene length (bp)1544
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 3.5E-09 145 180
PF00627 UBA UBA/TS-N domain 1.3E-12 324 359
PF09280 XPC-binding XPC-binding domain 6.5E-23 249 304
PF00240 ubiquitin Ubiquitin family 2.4E-21 4 73
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 9.1E-07 1 67

GO

GO Term Description Terminal node
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:0006289 nucleotide-excision repair Yes
GO:0003684 damaged DNA binding Yes
GO:0005515 protein binding Yes
GO:0009987 cellular process No
GO:0006259 DNA metabolic process No
GO:0003677 DNA binding No
GO:0090304 nucleic acid metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0009056 catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006950 response to stress No
GO:0008152 metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0030163 protein catabolic process No
GO:0006281 DNA repair No
GO:0003674 molecular_function No
GO:0006974 cellular response to DNA damage stimulus No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0033554 cellular response to stress No
GO:0043170 macromolecule metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:1901575 organic substance catabolic process No
GO:0003676 nucleic acid binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:1901565 organonitrogen compound catabolic process No
GO:0097159 organic cyclic compound binding No
GO:0050896 response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0044248 cellular catabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0051716 cellular response to stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006508 proteolysis No
GO:0051603 proteolysis involved in protein catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup6644
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1544.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g5506.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g7440.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g61.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g10418.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g5506.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g7045.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g5194.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g643.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g374.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g786.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g6176.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g4172.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g173.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g1726.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g5809.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g9226.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g4595.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g2095.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g6358.t1 (this protein)
Aspergillus niger CBS 147371 Ani_SJS27_1|g1411.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g1330.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g5989.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g7403.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6358.t1
MKLTFKDLKQQKFVIDAEPSETVGQVKEKISKEKGWEVPQLKLIYSGKILQDDKTIESYNIEEKGFIVCMVSKPK
ATSSGTSSQAPSTPSRAVTSTPAAPPAPAPSAASTTPAVPSTPSPAAAGTSQAQGSAFNDPSALLSGTQSEAVVA
QMEAMGFARSDVNRAMRAAFFNPDRAIEYLLNGIPENIQQEQQQQAAAASAPQSAAPESAPSAGDDEPVNLFEAA
AQAGGQEGGGRGARAAGGAELPSLEFLRNNPHFQQLRQLVQQQPQMLEPILQQVAAGNPQIAQLIGQNEEQFLQL
LSEEPDDDEALPPGTTQIHVTEEERDAIERLCRLGFSRDLVIQAYFACDKNEELAANYLFENPDDPEDM*
Coding >Ani_SJS100_1|g6358.t1
ATGAAGCTCACGTTTAAGGACCTGAAACAACAAAAGTTTGTAATCGATGCAGAGCCCTCAGAGACGGTCGGGCAA
GTGAAGGAAAAGATCTCCAAGGAGAAGGGATGGGAGGTTCCTCAGCTTAAGCTCATCTACTCTGGAAAGATCCTT
CAGGATGACAAGACGATCGAGTCATACAACATCGAGGAGAAGGGGTTCATAGTGTGCATGGTCTCTAAGCCCAAG
GCTACTTCCTCCGGCACCTCGTCACAAGCGCCCTCCACCCCATCCAGAGCCGTCACCTCTACCCCTGCTGCGCCT
CCCGCCCCAGCCCCTTCTGCGGCTTCCACTACACCGGCTGTTCCTTCGACTCCCTCCCCGGCCGCCGCGGGGACC
TCCCAGGCACAGGGCTCCGCATTCAATGACCCCTCCGCATTGCTGAGTGGCACTCAGAGCGAGGCTGTCGTGGCT
CAGATGGAGGCAATGGGTTTCGCCCGGAGTGATGTAAACCGTGCAATGAGGGCTGCTTTCTTTAACCCCGATCGT
GCCATCGAATACCTTTTGAATGGTATTCCGGAAAACATCCAACAGGAACAGCAGCAGCAAGCCGCCGCCGCTAGC
GCACCCCAGTCTGCTGCTCCCGAAAGCGCCCCGTCCGCTGGTGACGACGAACCGGTCAACCTGTTCGAAGCTGCT
GCTCAGGCTGGTGGCCAGGAGGGAGGAGGCCGAGGAGCTCGTGCTGCCGGTGGTGCTGAACTCCCGAGCCTCGAA
TTTCTGCGGAATAACCCCCACTTCCAGCAGCTTCGTCAGTTGGTCCAACAACAACCACAAATGCTCGAACCCATC
CTCCAACAAGTCGCCGCTGGAAACCCCCAAATTGCGCAGCTCATTGGCCAAAATGAGGAACAGTTCCTGCAGCTC
CTGAGTGAGGAGCCTGATGATGATGAGGCGCTCCCCCCTGGTACGACTCAAATTCATGTTACGGAAGAAGAGAGA
GATGCCATTGAACGTCTCTGCCGGCTTGGATTCTCTCGGGACTTGGTCATTCAAGCTTATTTCGCTTGCGATAAG
AATGAAGAGCTCGCAGCTAACTATCTGTTTGAGAACCCCGACGATCCCGAAGATATGTGA
Transcript >Ani_SJS100_1|g6358.t1
ATGAAGCTCACGTTTAAGGACCTGAAACAACAAAAGTTTGTAATCGATGCAGAGCCCTCAGAGACGGTCGGGCAA
GTGAAGGAAAAGATCTCCAAGGAGAAGGGATGGGAGGTTCCTCAGCTTAAGCTCATCTACTCTGGAAAGATCCTT
CAGGATGACAAGACGATCGAGTCATACAACATCGAGGAGAAGGGGTTCATAGTGTGCATGGTCTCTAAGCCCAAG
GCTACTTCCTCCGGCACCTCGTCACAAGCGCCCTCCACCCCATCCAGAGCCGTCACCTCTACCCCTGCTGCGCCT
CCCGCCCCAGCCCCTTCTGCGGCTTCCACTACACCGGCTGTTCCTTCGACTCCCTCCCCGGCCGCCGCGGGGACC
TCCCAGGCACAGGGCTCCGCATTCAATGACCCCTCCGCATTGCTGAGTGGCACTCAGAGCGAGGCTGTCGTGGCT
CAGATGGAGGCAATGGGTTTCGCCCGGAGTGATGTAAACCGTGCAATGAGGGCTGCTTTCTTTAACCCCGATCGT
GCCATCGAATACCTTTTGAATGGTATTCCGGAAAACATCCAACAGGAACAGCAGCAGCAAGCCGCCGCCGCTAGC
GCACCCCAGTCTGCTGCTCCCGAAAGCGCCCCGTCCGCTGGTGACGACGAACCGGTCAACCTGTTCGAAGCTGCT
GCTCAGGCTGGTGGCCAGGAGGGAGGAGGCCGAGGAGCTCGTGCTGCCGGTGGTGCTGAACTCCCGAGCCTCGAA
TTTCTGCGGAATAACCCCCACTTCCAGCAGCTTCGTCAGTTGGTCCAACAACAACCACAAATGCTCGAACCCATC
CTCCAACAAGTCGCCGCTGGAAACCCCCAAATTGCGCAGCTCATTGGCCAAAATGAGGAACAGTTCCTGCAGCTC
CTGAGTGAGGAGCCTGATGATGATGAGGCGCTCCCCCCTGGTACGACTCAAATTCATGTTACGGAAGAAGAGAGA
GATGCCATTGAACGTCTCTGCCGGCTTGGATTCTCTCGGGACTTGGTCATTCAAGCTTATTTCGCTTGCGATAAG
AATGAAGAGCTCGCAGCTAACTATCTGTTTGAGAACCCCGACGATCCCGAAGATATGTGA
Gene >Ani_SJS100_1|g6358.t1
ATGAAGCTCACGTTTAAGGTACGCGTGATTCCTACCCCACCCCCTCTACTTATCCTCGAGTCTGACATGTTCGTT
CTCTCCCTCTAGGACCTGAAACAACAAAAGTTTGTAATCGATGCAGAGCCCTCAGAGACGGTAGGCGGTTCCTTT
CTCTCAGCGTCGTGACTTTGCCGGCGTCAGTGCGGGGCTAAATGAATTATCCGACAGGTCGGGCAAGTGAAGGAA
AAGATCTCCAAGGAGAAGGGATGGGAGGTTCCTCAGCTTAAGCTCATCTACTCTGGTAAGTAAAGCAACTTTGGC
GTCCTACACTTGCTGCTCTATTTCCGATAGCCTTCTGCCACTCTGTTTGGCCGGTATTTCAGCGCTGACCGTTCT
TCCCCCCCAACAGGAAAGATCCTTCAGGATGACAAGACGATCGAGTCATACAACATCGAGGAGAAGGGGTTCATA
GTGTGCATGGTCTCTAAGGTACGTACACCCTAGGCCAAGGATATATTTCGTATGAATGAAGGACTAAATTCTCGT
GGTGTAGCCCAAGGCTACTTCCTCCGGCACCTCGTCACAAGCGCCCTCCACCCCATCCAGAGCCGTCACCTCTAC
CCCTGCTGCGCCTCCCGCCCCAGCCCCTTCTGCGGCTTCCACTACACCGGCTGTTCCTTCGACTCCCTCCCCGGC
CGCCGCGGGGACCTCCCAGGCACAGGGCTCCGCATTCAATGACCCCTCCGCATTGCTGAGTGGCACTCAGAGCGA
GGCTGTCGTGGCTCAGATGGAGGCAATGGGTTTCGCCCGGAGTGATGTAAACCGTGCAATGAGGGCTGCTTTCTT
TAACCCCGATCGTGCCATCGAATACCTTTTGAATGTGAGTTCATGGCGCTGGTAGCCGGCTATTGGGTTGCCCGA
TCTTGCGCTGACTTTAAGCAGGGTATTCCGGAAAACATCCAACAGGAACAGCAGCAGCAAGCCGCCGCCGCTAGC
GCACCCCAGTCTGCTGCTCCCGAAAGCGCCCCGTCCGCTGGTGACGACGAACCGGTCAACCTGTTCGAAGCTGCT
GCTCAGGCTGGTGGCCAGGAGGGAGGAGGCCGAGGAGCTCGTGCTGCCGGTGGTGCTGAACTCCCGAGCCTCGAA
TTTCTGCGGAATAACCCCCACTTCCAGCAGCTTCGTCAGTTGGTCCAACAACAACCACAAATGCTCGAACCCATC
CTCCAACAAGTCGCCGCTGGAAACCCCCAAATTGCGCAGCTCATTGGCCAAAATGAGGAACAGTTCCTGCAGCTC
CTGAGTGAGGAGCCTGATGATGATGAGGCGCTCCCCCCTGGTACGACTCAAATTCATGTTACGGAAGAAGAGAGA
GATGCCATTGAACGTGTGCGTATAATATACTCTGGTAATTCCTTGTGGAAATGTAGCTGACATGTTTCTGCTAGC
TCTGCCGGCTTGGATTCTCTCGGGACTTGGTCATTCAAGCTTATTTCGCTTGCGATAAGAATGAAGAGCTCGCAG
CTAACTATCTGTTTGAGAACCCCGACGATCCCGAAGATATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail