Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6329.t1
Gene name
Locationscaffold_039:10248..11781
Strand+
Gene length (bp)1533
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03114 BAR BAR domain 2.9E-51 5 225
PF10455 BAR_2 Bin/amphiphysin/Rvs domain for vesicular trafficking 1.1E-06 114 221

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005515 protein binding Yes
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6329.t1
MNVNRKFDRFKQWAGERMGGEAKTTLSDDFKALETEMNVRHEGIDRIHKATGSYIKSISKRSEGDDKEKTLPIAH
LGSSMVGHGEDFDANSEYGRCMTMLGRAEERLARLQDAYISQVNAGWLESLEHSLTQMKEYQTARKKLDSRRLAY
DTSLSKMEKAKREDFRVEEELRTQKVKYEEANDDVSRRMQDIKDSEVDGVANLEAFLEAQLDYHERCRDVLLQLR
YDWPSRAQPPSTRRPGRPRSNTAHSYHERYEPLHEETDNTADLRPIIRSTRASSIEPAAREVYPPDAFSQRPALN
RTTTFEGPTQLRQEQSPGTYQWPSRAASDNYIGRRNSVQSRTMGRSYVDPYMEQSEEPSPISGTSPERTYMGRNP
SPVSSYGGAVSRKSSSTTLNGTPLNKKAPPPPPPRSKKPAPPPPPMKRPILSAGEY*
Coding >Ani_SJS100_1|g6329.t1
ATGAACGTCAATCGCAAGTTCGATCGCTTCAAGCAATGGGCGGGGGAGAGAATGGGCGGAGAGGCCAAGACCACT
CTCTCCGATGACTTCAAAGCCTTGGAAACAGAGATGAACGTGCGCCACGAGGGAATTGACCGTATCCACAAGGCG
ACTGGCTCTTACATCAAGTCCATTTCGAAGCGGAGTGAAGGTGACGATAAGGAAAAGACCTTGCCCATTGCTCAT
CTGGGTAGTAGCATGGTTGGCCATGGCGAAGACTTCGATGCGAACTCTGAGTACGGCCGCTGCATGACCATGCTT
GGAAGGGCCGAGGAGCGCCTGGCTCGTCTCCAGGACGCTTACATCTCCCAGGTAAACGCGGGGTGGCTGGAATCG
CTGGAGCATTCCTTGACTCAGATGAAAGAGTACCAGACTGCTCGCAAGAAGCTTGACAGCCGACGTCTGGCCTAC
GATACCTCCCTCTCGAAGATGGAGAAGGCGAAGAGGGAAGATTTCCGCGTGGAGGAAGAGCTCCGGACCCAGAAG
GTCAAATATGAAGAGGCCAACGATGATGTATCACGGCGCATGCAGGACATCAAGGACTCCGAAGTTGACGGTGTT
GCGAACCTGGAAGCGTTCCTGGAGGCTCAGCTTGACTATCACGAGCGCTGTCGTGATGTTCTTCTCCAACTCAGA
TATGACTGGCCGAGCAGAGCCCAGCCTCCCAGCACCCGTCGTCCAGGACGCCCTCGCTCCAACACTGCGCATTCC
TATCATGAACGTTATGAACCACTGCATGAGGAGACCGACAACACGGCTGATCTGCGGCCTATTATTCGATCGACC
AGGGCATCTTCTATCGAGCCAGCTGCCAGAGAGGTCTACCCGCCAGATGCTTTCTCTCAGAGACCTGCTCTGAAC
AGAACTACGACATTTGAAGGACCTACGCAATTGCGCCAAGAGCAATCCCCTGGCACATACCAATGGCCATCCCGG
GCAGCTAGTGACAACTATATTGGCCGCAGAAATAGCGTGCAGTCCCGGACCATGGGCAGATCATATGTTGACCCG
TACATGGAACAGTCGGAGGAGCCTAGTCCTATTAGCGGCACCAGTCCCGAGAGGACGTATATGGGGCGGAATCCA
TCTCCAGTGTCTTCGTATGGAGGTGCTGTCTCGAGAAAGTCCAGCTCTACTACCTTAAATGGCACACCACTGAAC
AAGAAGGCTCCTCCACCCCCACCTCCCCGCTCCAAGAAGCCTGCGCCGCCACCGCCTCCCATGAAGCGCCCTATC
CTCAGTGCAGGCGAATACTGA
Transcript >Ani_SJS100_1|g6329.t1
ATGAACGTCAATCGCAAGTTCGATCGCTTCAAGCAATGGGCGGGGGAGAGAATGGGCGGAGAGGCCAAGACCACT
CTCTCCGATGACTTCAAAGCCTTGGAAACAGAGATGAACGTGCGCCACGAGGGAATTGACCGTATCCACAAGGCG
ACTGGCTCTTACATCAAGTCCATTTCGAAGCGGAGTGAAGGTGACGATAAGGAAAAGACCTTGCCCATTGCTCAT
CTGGGTAGTAGCATGGTTGGCCATGGCGAAGACTTCGATGCGAACTCTGAGTACGGCCGCTGCATGACCATGCTT
GGAAGGGCCGAGGAGCGCCTGGCTCGTCTCCAGGACGCTTACATCTCCCAGGTAAACGCGGGGTGGCTGGAATCG
CTGGAGCATTCCTTGACTCAGATGAAAGAGTACCAGACTGCTCGCAAGAAGCTTGACAGCCGACGTCTGGCCTAC
GATACCTCCCTCTCGAAGATGGAGAAGGCGAAGAGGGAAGATTTCCGCGTGGAGGAAGAGCTCCGGACCCAGAAG
GTCAAATATGAAGAGGCCAACGATGATGTATCACGGCGCATGCAGGACATCAAGGACTCCGAAGTTGACGGTGTT
GCGAACCTGGAAGCGTTCCTGGAGGCTCAGCTTGACTATCACGAGCGCTGTCGTGATGTTCTTCTCCAACTCAGA
TATGACTGGCCGAGCAGAGCCCAGCCTCCCAGCACCCGTCGTCCAGGACGCCCTCGCTCCAACACTGCGCATTCC
TATCATGAACGTTATGAACCACTGCATGAGGAGACCGACAACACGGCTGATCTGCGGCCTATTATTCGATCGACC
AGGGCATCTTCTATCGAGCCAGCTGCCAGAGAGGTCTACCCGCCAGATGCTTTCTCTCAGAGACCTGCTCTGAAC
AGAACTACGACATTTGAAGGACCTACGCAATTGCGCCAAGAGCAATCCCCTGGCACATACCAATGGCCATCCCGG
GCAGCTAGTGACAACTATATTGGCCGCAGAAATAGCGTGCAGTCCCGGACCATGGGCAGATCATATGTTGACCCG
TACATGGAACAGTCGGAGGAGCCTAGTCCTATTAGCGGCACCAGTCCCGAGAGGACGTATATGGGGCGGAATCCA
TCTCCAGTGTCTTCGTATGGAGGTGCTGTCTCGAGAAAGTCCAGCTCTACTACCTTAAATGGCACACCACTGAAC
AAGAAGGCTCCTCCACCCCCACCTCCCCGCTCCAAGAAGCCTGCGCCGCCACCGCCTCCCATGAAGCGCCCTATC
CTCAGTGCAGGCGAATACTGA
Gene >Ani_SJS100_1|g6329.t1
ATGAACGTCAATCGCAAGTTCGATCGCTTCAAGCAATGGGCGGGGGAGAGAATGGGCGGAGAGGCCAAGACCACT
CTCTCCGATGACTTCAAAGCCTTGGAAACAGAGATGAACGTGCGCCACGAGGGTAAGGATCACGACACCCAAGTC
TCATGGTATATATCCGGTCCATTTACTCATTTGCTACCCTTTAGGAATTGACCGTATCCACAAGGCGACTGGCTC
TTACATCAAGTCCATTTCGAAGCGGAGTGAAGGTGACGATAAGGAAAAGACCTTGCCCATTGCTCATCTGGGTAG
TAGCATGGTTGGCCATGGCGAAGACTTCGATGCGAACTCTGAGTACGGCCGCTGCATGACCAGTAAGCTAACATT
ACTACTGATTCGCAAGCTTTATGCTGATGACGTTGTCTACGCAGTGCTTGGAAGGGCCGAGGAGCGCCTGGCTCG
TCTCCAGGACGCTTACATCTCCCAGGTAAACGCGGGGTGGCTGGAATCGCTGGAGCATTCCTTGACTCAGATGAA
AGAGTACCAGGTATGACGGAGTTTGCGAGCACCAATTGAGTGGTCTGAAATGCTGACTCGATGTTTCACAGACTG
CTCGCAAGAAGCTTGACAGCCGACGTCTGGCCTACGATACCTCCCTCTCGAAGATGGAGAAGGCGAAGAGGGAAG
ATTTCCGCGTGGAGGAAGAGCTCCGGACCCAGAAGGTCAAATATGAAGAGGCCAACGATGATGTATCACGGCGCA
TGCAGGACATCAAGGACTCCGAAGTTGACGGTGTTGCGAACCTGGAAGCGTTCCTGGAGGCTCAGCTTGACTATC
ACGAGCGCTGTCGTGATGTTCTTCTCCAACTCAGATATGACTGGCCGAGCAGGTGAGGATTGCTTGAATTGTAAA
GCTACATCGTCATGCTAACGTACTAGCAGAGCCCAGCCTCCCAGCACCCGTCGTCCAGGACGCCCTCGCTCCAAC
ACTGCGCATTCCTATCATGAACGTTATGAACCACTGCATGAGGAGACCGACAACACGGCTGATCTGCGGCCTATT
ATTCGATCGACCAGGGCATCTTCTATCGAGCCAGCTGCCAGAGAGGTCTACCCGCCAGATGCTTTCTCTCAGAGA
CCTGCTCTGAACAGAACTACGACATTTGAAGGACCTACGCAATTGCGCCAAGAGCAATCCCCTGGCACATACCAA
TGGCCATCCCGGGCAGCTAGTGACAACTATATTGGCCGCAGAAATAGCGTGCAGTCCCGGACCATGGGCAGATCA
TATGTTGACCCGTACATGGAACAGTCGGAGGAGCCTAGTCCTATTAGCGGCACCAGTCCCGAGAGGACGTATATG
GGGCGGAATCCATCTCCAGTGTCTTCGTATGGAGGTGCTGTCTCGAGAAAGTCCAGCTCTACTACCTTAAATGGC
ACACCACTGAACAAGAAGGCTCCTCCACCCCCACCTCCCCGCTCCAAGAAGCCTGCGCCGCCACCGCCTCCCATG
AAGCGCCCTATCCTCAGTGCAGGCGAATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail