Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6203.t1
Gene name
Locationscaffold_037:218500..220481
Strand-
Gene length (bp)1981
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18647 Fungal_lectin_2 Alpha-galactosyl-binding fungal lectin 1.3E-39 421 519
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 6.9E-11 43 241

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6203.t1
MIWFIFLLVILVTGTPDIDAPQDNPPETHLPITDLTFIRTWAAIGDSYTAGIGAGDLWSDRKEDYKCSRYDKSYV
ALLKHLLGPQVEKFSYKACSGARTGDIYNQARELDKFHDLIVMTGGGNDLCLSDIITTCIFLPFNNEEKCQKVIE
LAQYNIKQILKSNVREVLEVAVGKVNQFGIIIYALYGQFFNTETDDCEKNQDWAFPGLAPFNALPLTRERRQQFN
QLVVDTNKVIKQAIDDFVLEKGKYYPRVHIRTADWDAFMKDGLKGQFCAPESTGKYPDPMQPNLHFFKPDTSIER
HTELKAKRDNITDTSTTSSSTDDPLSSFYNSVLFRSPNPPAAALHKLNPRDPKPPGCPGDGGVGFGLPDRWGKYF
HPNELGHKTIASFVLDGIFASRADFLGRKNPICQHSFDEFRCWQQDGRKDYASADLLNKNYKTYCKEVKPPKKTA
NWKDERWFNQLTPETHYFSIQLSDGATQFDYGHCIESFERIINSCDGNDPENPLNWKFGGRWTRGSYTYEVNVQN
SFKRPWPPTKEVGGFCDSSFKGFFQKYNMRGRGWATWDAGQDTLKPAITSCVGLGLTGWDFKYLDEPDSDGNEWV
ASFNTPILTGPRCFDNNQVQFNAGGFTRGCHGVQRHDA*
Coding >Ani_SJS100_1|g6203.t1
ATGATTTGGTTCATATTCCTGCTGGTGATTCTTGTCACTGGCACTCCCGACATTGATGCTCCTCAAGATAATCCC
CCCGAAACTCATCTCCCCATCACAGACCTCACCTTCATCCGCACATGGGCCGCCATTGGCGACAGCTACACAGCA
GGTATTGGCGCCGGTGATCTGTGGTCTGACAGAAAAGAGGACTACAAATGTTCCCGCTATGACAAGTCGTATGTA
GCCCTCCTGAAGCATTTGTTGGGTCCACAGGTGGAAAAATTCTCGTACAAAGCATGCAGTGGCGCTCGCACTGGC
GACATCTACAACCAGGCCCGGGAGCTTGATAAATTCCACGACCTCATAGTCATGACTGGTGGAGGAAATGACTTG
TGCTTGTCCGATATTATCACCACCTGCATCTTTCTCCCTTTCAACAACGAAGAAAAGTGTCAGAAGGTCATTGAG
TTGGCTCAATATAACATCAAGCAGATTCTCAAGTCCAACGTTCGCGAAGTCCTTGAAGTCGCTGTGGGCAAGGTG
AATCAGTTTGGCATCATTATCTACGCCCTCTACGGCCAGTTCTTCAACACGGAGACCGATGACTGCGAGAAGAAT
CAGGACTGGGCCTTCCCTGGTCTGGCTCCATTCAATGCTTTACCTTTGACCCGCGAGCGTCGCCAGCAATTCAAT
CAACTGGTTGTCGACACCAACAAGGTCATAAAACAAGCCATCGATGATTTCGTCTTGGAAAAAGGAAAGTACTAC
CCACGAGTGCATATCCGTACCGCCGATTGGGATGCCTTCATGAAAGACGGCCTCAAAGGACAGTTCTGCGCCCCT
GAATCAACAGGAAAATATCCCGATCCCATGCAGCCCAACTTGCACTTCTTCAAGCCCGATACCTCCATTGAACGC
CACACGGAACTGAAAGCGAAGCGCGACAACATCACCGACACATCCACCACCTCCTCCTCTACCGACGACCCTCTT
TCCTCCTTCTACAACTCCGTCCTCTTCCGCTCGCCCAACCCCCCGGCAGCTGCCCTCCACAAGCTGAACCCCCGC
GACCCCAAACCCCCAGGCTGCCCGGGTGACGGGGGTGTAGGATTCGGGCTCCCCGACCGCTGGGGCAAGTACTTC
CACCCAAACGAGCTCGGCCACAAGACCATTGCCTCCTTCGTGCTTGACGGCATATTTGCCTCACGGGCTGATTTC
CTCGGCAGGAAGAACCCCATCTGCCAGCACAGTTTCGACGAATTCCGATGCTGGCAACAAGACGGCCGGAAAGAC
TACGCAAGCGCGGACCTCCTAAACAAAAACTACAAGACCTACTGCAAGGAAGTAAAGCCTCCCAAGAAAACAGCA
AACTGGAAAGACGAGCGCTGGTTCAACCAACTCACCCCAGAAACGCACTACTTCAGCATCCAACTCAGCGATGGT
GCCACTCAGTTCGACTACGGACACTGCATCGAGTCCTTCGAACGTATCATCAACTCCTGCGACGGCAACGATCCG
GAGAACCCGCTGAATTGGAAATTCGGGGGTCGCTGGACTCGCGGGAGCTATACTTACGAAGTTAACGTTCAGAAC
TCGTTCAAGAGACCTTGGCCGCCGACGAAGGAAGTTGGAGGGTTTTGCGATAGTAGTTTTAAGGGGTTTTTCCAA
AAATATAATATGAGAGGGAGGGGATGGGCGACTTGGGATGCGGGCCAGGATACGCTCAAGCCGGCTATTACAAGC
TGCGTGGGACTGGGACTTACGGGGTGGGACTTTAAGTATTTGGATGAGCCGGACTCTGATGGGAATGAGTGGGTG
GCTAGTTTTAATACGCCTATCTTGACGGGTCCTCGGTGCTTTGATAATAATCAGGTGCAGTTCAACGCGGGGGGT
TTCACGCGGGGTTGTCATGGGGTGCAGCGACATGATGCTTGA
Transcript >Ani_SJS100_1|g6203.t1
ATGATTTGGTTCATATTCCTGCTGGTGATTCTTGTCACTGGCACTCCCGACATTGATGCTCCTCAAGATAATCCC
CCCGAAACTCATCTCCCCATCACAGACCTCACCTTCATCCGCACATGGGCCGCCATTGGCGACAGCTACACAGCA
GGTATTGGCGCCGGTGATCTGTGGTCTGACAGAAAAGAGGACTACAAATGTTCCCGCTATGACAAGTCGTATGTA
GCCCTCCTGAAGCATTTGTTGGGTCCACAGGTGGAAAAATTCTCGTACAAAGCATGCAGTGGCGCTCGCACTGGC
GACATCTACAACCAGGCCCGGGAGCTTGATAAATTCCACGACCTCATAGTCATGACTGGTGGAGGAAATGACTTG
TGCTTGTCCGATATTATCACCACCTGCATCTTTCTCCCTTTCAACAACGAAGAAAAGTGTCAGAAGGTCATTGAG
TTGGCTCAATATAACATCAAGCAGATTCTCAAGTCCAACGTTCGCGAAGTCCTTGAAGTCGCTGTGGGCAAGGTG
AATCAGTTTGGCATCATTATCTACGCCCTCTACGGCCAGTTCTTCAACACGGAGACCGATGACTGCGAGAAGAAT
CAGGACTGGGCCTTCCCTGGTCTGGCTCCATTCAATGCTTTACCTTTGACCCGCGAGCGTCGCCAGCAATTCAAT
CAACTGGTTGTCGACACCAACAAGGTCATAAAACAAGCCATCGATGATTTCGTCTTGGAAAAAGGAAAGTACTAC
CCACGAGTGCATATCCGTACCGCCGATTGGGATGCCTTCATGAAAGACGGCCTCAAAGGACAGTTCTGCGCCCCT
GAATCAACAGGAAAATATCCCGATCCCATGCAGCCCAACTTGCACTTCTTCAAGCCCGATACCTCCATTGAACGC
CACACGGAACTGAAAGCGAAGCGCGACAACATCACCGACACATCCACCACCTCCTCCTCTACCGACGACCCTCTT
TCCTCCTTCTACAACTCCGTCCTCTTCCGCTCGCCCAACCCCCCGGCAGCTGCCCTCCACAAGCTGAACCCCCGC
GACCCCAAACCCCCAGGCTGCCCGGGTGACGGGGGTGTAGGATTCGGGCTCCCCGACCGCTGGGGCAAGTACTTC
CACCCAAACGAGCTCGGCCACAAGACCATTGCCTCCTTCGTGCTTGACGGCATATTTGCCTCACGGGCTGATTTC
CTCGGCAGGAAGAACCCCATCTGCCAGCACAGTTTCGACGAATTCCGATGCTGGCAACAAGACGGCCGGAAAGAC
TACGCAAGCGCGGACCTCCTAAACAAAAACTACAAGACCTACTGCAAGGAAGTAAAGCCTCCCAAGAAAACAGCA
AACTGGAAAGACGAGCGCTGGTTCAACCAACTCACCCCAGAAACGCACTACTTCAGCATCCAACTCAGCGATGGT
GCCACTCAGTTCGACTACGGACACTGCATCGAGTCCTTCGAACGTATCATCAACTCCTGCGACGGCAACGATCCG
GAGAACCCGCTGAATTGGAAATTCGGGGGTCGCTGGACTCGCGGGAGCTATACTTACGAAGTTAACGTTCAGAAC
TCGTTCAAGAGACCTTGGCCGCCGACGAAGGAAGTTGGAGGGTTTTGCGATAGTAGTTTTAAGGGGTTTTTCCAA
AAATATAATATGAGAGGGAGGGGATGGGCGACTTGGGATGCGGGCCAGGATACGCTCAAGCCGGCTATTACAAGC
TGCGTGGGACTGGGACTTACGGGGTGGGACTTTAAGTATTTGGATGAGCCGGACTCTGATGGGAATGAGTGGGTG
GCTAGTTTTAATACGCCTATCTTGACGGGTCCTCGGTGCTTTGATAATAATCAGGTGCAGTTCAACGCGGGGGGT
TTCACGCGGGGTTGTCATGGGGTGCAGCGACATGATGCTTGA
Gene >Ani_SJS100_1|g6203.t1
ATGATTTGGTTCATATTCCTGCTGGTGATTCTTGTCACTGGCACTCCCGACATTGATGCTCCTCAAGATAATCCC
CCCGAAACTCATCTCCCCATCACAGACCTCACCTTCATCCGCACATGGGCCGCCATTGGCGACAGCTACACAGCA
GGTATTGGCGCCGGTGATCTGTGGTCTGACAGAAAAGAGGACTACAAATGTTCCCGCTATGACAAGTCGTATGTA
GCCCTCCTGAAGCATTTGTTGGGTCCACAGGTGGAAAAATTCTCGTACAAAGCATGCAGTGGCGCTCGCACTGGC
GACATCTACAACCAGGCCCGGGAGCTTGATAAATTCCACGACCTCATAGTCATGACTGGTGGAGGAAATGACTTG
TGCTTGGTATGCTAGCCTCTTCTTCTTCATTCATCTCACTATAGTGAACCCTAACTGACAGACTGCACAGTCCGA
TATTATCACCACCTGCATCTTTCTCCCTTTCAACAACGAAGAAAAGTGTCAGAAGGTCATTGAGTTGGCTCAATA
TAACATCAAGCAGATTCTCAAGTCCAACGTTCGCGAAGTCCTTGAAGTCGCTGTGGGCAAGGTGAATCAGTTTGG
CATCATTATCTACGCCCTCTACGGCCAGTTCTTCAACACGGAGACCGATGACTGCGAGAAGAATCAGGACTGGGC
CTTCCCTGGTCTGGCTCCATTCAATGCTTTACCTTTGACCCGCGAGCGTCGCCAGCAATTCAATCAACTGGTTGT
CGACACCAACAAGGTCATAAAACAAGCCATCGATGATTTCGTCTTGGAAAAAGGAAAGTACTACCCACGAGTGCA
TATCCGTACCGCCGATTGGGATGCCTTCATGAAAGACGGCCTCAAAGGACAGTTCTGCGCCCCTGAATCAACAGG
AAAATATCCCGATCCCATGCAGCCCAACTTGCACTTCTTCAAGCCCGATACCTCCATTGAACGCCACACGGAACT
GAAAGCGAAGCGCGACAACATCACCGACACATCCACCACCTCCTCCTCTACCGACGACCCTCTTTCCTCCTTCTA
CAACTCCGTCCTCTTCCGCTCGCCCAACCCCCCGGCAGCTGCCCTCCACAAGCTGAACCCCCGCGACCCCAAACC
CCCAGGCTGCCCGGGTGACGGGGGTGTAGGATTCGGGCTCCCCGACCGCTGGGGCAAGTACTTCCACCCAAACGA
GCTCGGCCACAAGACCATTGCCTCCTTCGTGCTTGACGGCATATTTGCCTCACGGGCTGATTTCCTCGGCAGGAA
GAACCCCATCTGCCAGCACAGTTTCGACGAATTCCGATGCTGGCAACAAGACGGCCGGAAAGACTACGCAAGCGC
GGACCTCCTAAACAAAAACTACAAGACCTACTGCAAGGAAGTAAAGCCTCCCAAGAAAACAGCAAACTGGAAAGA
CGAGCGCTGGTTCAACCAACTCACCCCAGAAACGCACTACTTCAGCATCCAACTCAGCGATGGTGCCACTCAGTT
CGACTACGGACACTGCATCGAGTCCTTCGAACGTATCATCAACTCCTGCGACGGCAACGATCCGGAGAACCCGCT
GAATTGGAAATTCGGGGGTCGCTGGACTCGCGGGAGCTATACTTACGAAGTTAACGTTCAGAACTCGTTCAAGAG
ACCTTGGCCGCCGACGAAGGAAGTTGGAGGGTTTTGCGATAGTAGTTTTAAGGGGTTTTTCCAAAAATATAATAT
GAGAGGGAGGGGATGGGCGACTTGGGATGCGGGCCAGGATACGCTCAAGCCGGCTATTACAAGCTGCGTGGGACT
GGGACTTACGGGGTGGGACTTTAAGTATTTGGATGAGCCGGACTCTGATGGGAATGAGTGGGTGGCTAGTTTTAA
TACGCCTATCTTGACGGGTCCTCGGTGCTTTGATAATAATCAGGTGCAGTTCAACGCGGGGGGTTTCACGCGGGG
TTGTCATGGGGTGCAGCGACATGATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail