Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6084.t1
Gene name
Locationscaffold_036:169571..171160
Strand-
Gene length (bp)1589
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 2.8E-11 88 228

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 83 105 22
2 120 142 22
3 155 177 22
4 187 209 22
5 216 233 17
6 253 275 22
7 287 309 22
8 324 346 22
9 399 421 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6084.t1
MSLNPSDARGVNSTAGEETQQYVTLLPAQNQVDEQHQQHVVYSEQTPLLRSGLGHESASASSAMHHYSSQPWWKT
AQQVACDVWLQGKGMILVMFSQFFGASMNVMTQFLEIKGRDGKGFHPFQILFARMSITVLASYLYMWYARVPHPF
GTRDTFTLLMLRAGGGFFGVYGLYYSVQYLPLSEATVVTFLAPILSCYACSLLIPNEFFTRKQQLAGLVSLAGVV
LIARPFPFMRSGGDSEPEQGDKPGATDSYHHVLAIVVALFGVLGASCAYTTIRMIGQRCHPLVSVTYFSTFTTVV
ATLAMLVVPSIPLELPGTVLEWTLLLGLGVSGFLLQFLLTAGLAYVPPVRKTKASVDWNRDYGTRDEEEEPSAKP
TSSGSRATFMLYTQMLFAVFYDRAIWGSTLSAVSWMGSVLILVSAMYVAMAREGAKGTSSEEKEGGDQEGTDENR
AGVAAEERLEEGGGRQVSGGRA*
Coding >Ani_SJS100_1|g6084.t1
ATGTCTCTGAATCCATCTGACGCAAGGGGCGTCAACTCGACCGCGGGTGAAGAAACTCAACAATATGTAACTTTA
CTACCGGCTCAGAATCAAGTCGATGAGCAGCACCAACAGCACGTTGTCTATTCGGAGCAGACGCCGCTGCTTCGG
TCGGGACTTGGTCATGAGTCTGCTTCTGCTTCTTCAGCAATGCATCACTATTCATCTCAGCCCTGGTGGAAGACG
GCGCAGCAGGTAGCCTGCGATGTCTGGCTGCAGGGCAAGGGCATGATCCTGGTCATGTTCTCGCAATTCTTTGGC
GCGTCGATGAATGTCATGACGCAATTTTTGGAAATCAAAGGTCGTGATGGGAAGGGGTTTCATCCGTTTCAGATC
CTGTTCGCCCGCATGTCTATCACGGTTCTCGCTAGTTACCTCTACATGTGGTATGCGCGTGTACCGCATCCGTTC
GGAACGCGCGATACCTTCACTCTGCTGATGCTGCGCGCCGGAGGTGGATTCTTTGGCGTCTACGGGCTCTATTAC
TCCGTGCAGTACCTGCCGCTCTCCGAGGCGACCGTGGTGACCTTTTTAGCGCCGATCCTGAGCTGCTATGCTTGC
TCGCTTTTGATCCCCAACGAGTTCTTCACGCGCAAGCAGCAGCTCGCCGGACTGGTCTCGCTGGCGGGTGTCGTT
CTCATCGCTCGGCCGTTCCCGTTCATGCGATCGGGCGGCGACTCCGAGCCGGAGCAGGGCGATAAGCCCGGTGCC
ACCGATAGCTACCACCACGTGCTGGCCATCGTGGTGGCTCTGTTCGGAGTGCTGGGTGCCTCGTGTGCGTACACC
ACGATCCGGATGATCGGACAGCGCTGCCACCCGCTCGTCTCGGTGACTTACTTCTCCACATTCACGACAGTCGTA
GCTACGCTGGCGATGCTGGTCGTGCCATCGATTCCGCTGGAGCTGCCGGGCACAGTGCTGGAATGGACGCTGCTT
CTGGGGTTAGGTGTCAGCGGATTCCTGCTGCAGTTCCTGCTCACAGCAGGTCTGGCATATGTACCGCCGGTGCGG
AAGACCAAGGCGTCAGTAGACTGGAACCGGGACTATGGCACGCGCGACGAGGAAGAAGAGCCGTCCGCGAAGCCA
ACATCGTCCGGATCACGGGCGACTTTCATGTTGTACACGCAGATGCTGTTTGCCGTGTTCTATGACCGGGCGATC
TGGGGTAGTACGTTGTCGGCGGTGAGCTGGATGGGATCAGTGCTGATCCTGGTGAGCGCCATGTATGTGGCCATG
GCGCGAGAGGGCGCAAAGGGAACCTCATCCGAGGAGAAGGAGGGCGGAGATCAAGAGGGCACGGACGAGAACCGG
GCTGGAGTGGCTGCAGAAGAGCGTCTGGAGGAAGGCGGGGGAAGGCAAGTGAGCGGGGGTCGCGCATGA
Transcript >Ani_SJS100_1|g6084.t1
ATGTCTCTGAATCCATCTGACGCAAGGGGCGTCAACTCGACCGCGGGTGAAGAAACTCAACAATATGTAACTTTA
CTACCGGCTCAGAATCAAGTCGATGAGCAGCACCAACAGCACGTTGTCTATTCGGAGCAGACGCCGCTGCTTCGG
TCGGGACTTGGTCATGAGTCTGCTTCTGCTTCTTCAGCAATGCATCACTATTCATCTCAGCCCTGGTGGAAGACG
GCGCAGCAGGTAGCCTGCGATGTCTGGCTGCAGGGCAAGGGCATGATCCTGGTCATGTTCTCGCAATTCTTTGGC
GCGTCGATGAATGTCATGACGCAATTTTTGGAAATCAAAGGTCGTGATGGGAAGGGGTTTCATCCGTTTCAGATC
CTGTTCGCCCGCATGTCTATCACGGTTCTCGCTAGTTACCTCTACATGTGGTATGCGCGTGTACCGCATCCGTTC
GGAACGCGCGATACCTTCACTCTGCTGATGCTGCGCGCCGGAGGTGGATTCTTTGGCGTCTACGGGCTCTATTAC
TCCGTGCAGTACCTGCCGCTCTCCGAGGCGACCGTGGTGACCTTTTTAGCGCCGATCCTGAGCTGCTATGCTTGC
TCGCTTTTGATCCCCAACGAGTTCTTCACGCGCAAGCAGCAGCTCGCCGGACTGGTCTCGCTGGCGGGTGTCGTT
CTCATCGCTCGGCCGTTCCCGTTCATGCGATCGGGCGGCGACTCCGAGCCGGAGCAGGGCGATAAGCCCGGTGCC
ACCGATAGCTACCACCACGTGCTGGCCATCGTGGTGGCTCTGTTCGGAGTGCTGGGTGCCTCGTGTGCGTACACC
ACGATCCGGATGATCGGACAGCGCTGCCACCCGCTCGTCTCGGTGACTTACTTCTCCACATTCACGACAGTCGTA
GCTACGCTGGCGATGCTGGTCGTGCCATCGATTCCGCTGGAGCTGCCGGGCACAGTGCTGGAATGGACGCTGCTT
CTGGGGTTAGGTGTCAGCGGATTCCTGCTGCAGTTCCTGCTCACAGCAGGTCTGGCATATGTACCGCCGGTGCGG
AAGACCAAGGCGTCAGTAGACTGGAACCGGGACTATGGCACGCGCGACGAGGAAGAAGAGCCGTCCGCGAAGCCA
ACATCGTCCGGATCACGGGCGACTTTCATGTTGTACACGCAGATGCTGTTTGCCGTGTTCTATGACCGGGCGATC
TGGGGTAGTACGTTGTCGGCGGTGAGCTGGATGGGATCAGTGCTGATCCTGGTGAGCGCCATGTATGTGGCCATG
GCGCGAGAGGGCGCAAAGGGAACCTCATCCGAGGAGAAGGAGGGCGGAGATCAAGAGGGCACGGACGAGAACCGG
GCTGGAGTGGCTGCAGAAGAGCGTCTGGAGGAAGGCGGGGGAAGGCAAGTGAGCGGGGGTCGCGCATGA
Gene >Ani_SJS100_1|g6084.t1
ATGTCTCTGAATCCATCTGACGCAAGGGGCGTCAACTCGACCGCGGGTGAAGAAACTCAACAATATGTAACTTTA
CTACCGGCTCAGAATCAAGTCGATGAGCAGCACCAACAGCACGTTGTCTATTCGGAGCAGACGCCGCTGCTTCGG
TCGGGACTTGGTCATGAGTCTGCTTCTGCTTCTTCAGCAATGCATCACTATTCATCTCAGCCCTGGTGGAAGACG
GCGCAGCAGGTAGCCTGCGATGTCTGGCTGCAGGGCAAGGGCATGATCCTGGTCATGTTCTCGCAATTCTTTGGC
GCGTCGATGAATGTCATGACGCAATTTTTGGAAATCAAAGGTCGTGATGGGAAGGGGTTTCATCCGTTTCAGGTG
CGTTCTATATCGCCTACCTATCTTTCTGCTGGAAAGCTCTGCTCTGCTCTGCTGCTAGTGGATGGATGATCTACT
GTGCGCTGTGTAGGGGACGTCCACTCGTGGGGCACCCTCTAGTAGACACTAGATATCCCTGCTCAGGAACCCGGC
TGATCCCGTAAGAACAGATCCTGTTCGCCCGCATGTCTATCACGGTTCTCGCTAGTTACCTCTACATGTGGTATG
CGCGTGTACCGCATCCGTTCGGAACGCGCGATACCTTCACTCTGCTGATGCTGCGCGCCGGAGGTGGATTCTTTG
GCGTCTACGGGCTCTATTACTCCGTGCAGTACCTGCCGCTCTCCGAGGCGACCGTGGTGACCTTTTTAGCGCCGA
TCCTGAGCTGCTATGCTTGCTCGCTTTTGATCCCCAACGAGTTCTTCACGCGCAAGCAGCAGCTCGCCGGACTGG
TCTCGCTGGCGGGTGTCGTTCTCATCGCTCGGCCGTTCCCGTTCATGCGATCGGGCGGCGACTCCGAGCCGGAGC
AGGGCGATAAGCCCGGTGCCACCGATAGCTACCACCACGTGCTGGCCATCGTGGTGGCTCTGTTCGGAGTGCTGG
GTGCCTCGTGTGCGTACACCACGATCCGGATGATCGGACAGCGCTGCCACCCGCTCGTCTCGGTGACTTACTTCT
CCACATTCACGACAGTCGTAGCTACGCTGGCGATGCTGGTCGTGCCATCGATTCCGCTGGAGCTGCCGGGCACAG
TGCTGGAATGGACGCTGCTTCTGGGGTTAGGTGTCAGCGGATTCCTGCTGCAGTTCCTGCTCACAGCAGGTCTGG
CATATGTACCGCCGGTGCGGAAGACCAAGGCGTCAGTAGACTGGAACCGGGACTATGGCACGCGCGACGAGGAAG
AAGAGCCGTCCGCGAAGCCAACATCGTCCGGATCACGGGCGACTTTCATGTTGTACACGCAGATGCTGTTTGCCG
TGTTCTATGACCGGGCGATCTGGGGTAGTACGTTGTCGGCGGTGAGCTGGATGGGATCAGTGCTGATCCTGGTGA
GCGCCATGTATGTGGCCATGGCGCGAGAGGGCGCAAAGGGAACCTCATCCGAGGAGAAGGAGGGCGGAGATCAAG
AGGGCACGGACGAGAACCGGGCTGGAGTGGCTGCAGAAGAGCGTCTGGAGGAAGGCGGGGGAAGGCAAGTGAGCG
GGGGTCGCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail