Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g6038.t1
Gene name
Locationscaffold_036:50583..51418
Strand-
Gene length (bp)835
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08234 Spindle_Spc25 Chromosome segregation protein Spc25 4.0E-22 183 254

GO

GO Term Description Terminal node
GO:0031262 Ndc80 complex Yes
GO:0007059 chromosome segregation Yes
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g6038.t1
MSSSFDPSLSTSGMRPPLTSADAPSMADSLPSINFGFEDLRNRMAQFTARFDAFIERGRKQVLEERNQFKIGLAE
LQEDERMKQRDIEILDLKSQTHQQTLQKEAAEAAEMHAAISSVTLERDSRLAKRDRLKQQIDETQKAINQKLEAQ
KMHARYLDAQARLNVPELDFWQDYLCLRIEGAGREDRLKFVYTHLLEKDWEAEAWFELGTGSRDYAVFHTRPKLD
REALERELDIVNEDRDFGAFLKRMRKLFVDTMK*
Coding >Ani_SJS100_1|g6038.t1
ATGAGCTCGTCTTTTGATCCGTCGCTCTCGACAAGTGGCATGCGCCCGCCTCTCACGTCGGCCGATGCACCGTCC
ATGGCCGATTCACTCCCCAGTATCAACTTCGGATTTGAAGATCTCCGAAATCGCATGGCACAGTTCACTGCTCGC
TTTGACGCTTTCATTGAGAGAGGCCGCAAGCAGGTATTGGAGGAGAGGAACCAGTTCAAGATTGGACTGGCAGAG
CTACAGGAGGATGAACGCATGAAGCAAAGGGACATCGAGATCCTGGATCTTAAATCGCAAACGCATCAGCAAACA
CTACAGAAGGAAGCCGCTGAAGCAGCGGAAATGCACGCCGCCATCTCATCCGTGACCCTGGAGCGCGACTCCCGC
CTCGCCAAGCGCGACCGCCTCAAGCAACAAATTGACGAGACCCAAAAGGCGATTAACCAGAAGTTGGAGGCACAG
AAGATGCACGCCAGATATCTGGATGCTCAGGCTCGGCTGAACGTGCCGGAATTGGACTTTTGGCAGGACTATCTG
TGTTTACGCATTGAGGGAGCCGGACGAGAGGATCGACTGAAGTTTGTTTACACCCATTTGCTCGAAAAAGACTGG
GAAGCGGAAGCGTGGTTTGAACTCGGAACAGGGAGCCGCGATTACGCAGTATTTCATACACGACCGAAACTCGAT
CGGGAGGCTCTCGAGCGTGAGCTCGATATCGTCAATGAGGATCGCGATTTCGGTGCGTTCTTGAAAAGAATGCGG
AAGTTGTTCGTCGATACCATGAAATAG
Transcript >Ani_SJS100_1|g6038.t1
ATGAGCTCGTCTTTTGATCCGTCGCTCTCGACAAGTGGCATGCGCCCGCCTCTCACGTCGGCCGATGCACCGTCC
ATGGCCGATTCACTCCCCAGTATCAACTTCGGATTTGAAGATCTCCGAAATCGCATGGCACAGTTCACTGCTCGC
TTTGACGCTTTCATTGAGAGAGGCCGCAAGCAGGTATTGGAGGAGAGGAACCAGTTCAAGATTGGACTGGCAGAG
CTACAGGAGGATGAACGCATGAAGCAAAGGGACATCGAGATCCTGGATCTTAAATCGCAAACGCATCAGCAAACA
CTACAGAAGGAAGCCGCTGAAGCAGCGGAAATGCACGCCGCCATCTCATCCGTGACCCTGGAGCGCGACTCCCGC
CTCGCCAAGCGCGACCGCCTCAAGCAACAAATTGACGAGACCCAAAAGGCGATTAACCAGAAGTTGGAGGCACAG
AAGATGCACGCCAGATATCTGGATGCTCAGGCTCGGCTGAACGTGCCGGAATTGGACTTTTGGCAGGACTATCTG
TGTTTACGCATTGAGGGAGCCGGACGAGAGGATCGACTGAAGTTTGTTTACACCCATTTGCTCGAAAAAGACTGG
GAAGCGGAAGCGTGGTTTGAACTCGGAACAGGGAGCCGCGATTACGCAGTATTTCATACACGACCGAAACTCGAT
CGGGAGGCTCTCGAGCGTGAGCTCGATATCGTCAATGAGGATCGCGATTTCGGTGCGTTCTTGAAAAGAATGCGG
AAGTTGTTCGTCGATACCATGAAATAG
Gene >Ani_SJS100_1|g6038.t1
ATGAGCTCGTCTTTTGATCCGTCGCTCTCGACAAGTGGCATGCGCCCGCCTCTCACGTCGGCCGATGCACCGTCC
ATGGCCGATTCACTCCCCAGTATCAACTTCGGATTTGAAGATCTCCGAAATCGCATGGCACAGTTCACTGCTCGC
TTTGACGCTTTCATTGAGAGAGGCCGCAAGCAGGTATTGGAGGAGAGGAACCAGTTCAAGATTGGACTGGCAGAG
CTACAGGGTAAGCTATCGCTTTATGGAGATGGCGCAAGAGCATCGGACTAACTCAGGTCCTGTAGAGGATGAACG
CATGAAGCAAAGGGACATCGAGATCCTGGATCTTAAATCGCAAACGCATCAGCAAACACTACAGAAGGAAGCCGC
TGAAGCAGCGGAAATGCACGCCGCCATCTCATCCGTGACCCTGGAGCGCGACTCCCGCCTCGCCAAGCGCGACCG
CCTCAAGCAACAAATTGACGAGACCCAAAAGGCGATTAACCAGAAGTTGGAGGCACAGAAGATGCACGCCAGATA
TCTGGATGCTCAGGCTCGGCTGAACGTGCCGGAATTGGACTTTTGGCAGGACTATCTGTGTTTACGCATTGAGGG
AGCCGGACGAGAGGATCGACTGAAGTTTGTTTACACCCATTTGCTCGAAAAAGACTGGGAAGCGGAAGCGTGGTT
TGAACTCGGAACAGGGAGCCGCGATTACGCAGTATTTCATACACGACCGAAACTCGATCGGGAGGCTCTCGAGCG
TGAGCTCGATATCGTCAATGAGGATCGCGATTTCGGTGCGTTCTTGAAAAGAATGCGGAAGTTGTTCGTCGATAC
CATGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail