Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5934.t1
Gene name
Locationscaffold_034:304570..306097
Strand+
Gene length (bp)1527
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 8.7E-13 10 216
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 4.7E-11 11 211
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.1E-07 8 214
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.6E-07 12 65
PF01946 Thi4 Thi4 family 2.1E-06 6 48

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0043168 anion binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5934.t1
MASPAVDYDVLIVGAGISGINAAYRLQTELPDLTFTILEGRATLGGTWDFFRYPGIRSDSDLFTFCFPWHPWEQA
YPIAEGATILQYIQQAASKHGIDRRIEFQHRVTRASWSSSDQVWHLTVESPEDTSIYRSRFLILGTGFYNYSQAL
KTEIPGLQQFQGTVVHPQFWPDGLDYRDQKIVVIGSGATAITMIPKLAEKAAHTTMLQRSPTYIVSMPNRQIPSA
SSWLARWLPRPRFYWVQRFLSLVYTRLFILFCERWPQLARAYLRSHVRRQLPPAVAYDPHFAPLYAPMEQRLCVS
PDADFFRSLHTGHVGVVTDTIETCTTTGIQLRSGQHLDADLIITATGLQMQFAGGALLDIDGVSVDLSSKFIWNG
MMLQDVPNAVVVNGYTNASWTLGADATMIAVCRLIKLLQARGHTVAVPRVDPQGPPLTPRPTFALTSTYIHAAAR
FMPRVAAEKPWQRRDNYFTDLWFAKYGDLEQGLEFIPGSGFRKPAKGGGETPKEVKRD*
Coding >Ani_SJS100_1|g5934.t1
ATGGCTTCACCTGCAGTTGACTACGATGTCCTCATCGTTGGAGCCGGCATTTCTGGCATTAACGCGGCCTACCGG
CTTCAGACCGAACTGCCCGATCTCACCTTCACTATCCTCGAGGGGCGGGCCACATTAGGGGGCACTTGGGATTTC
TTTCGCTATCCTGGCATCCGATCGGATTCGGACCTGTTCACCTTTTGCTTTCCCTGGCACCCATGGGAGCAAGCA
TATCCCATCGCCGAGGGCGCGACCATTCTACAGTATATCCAACAGGCTGCCTCGAAGCATGGCATCGACCGTCGG
ATTGAATTTCAGCACCGGGTGACAAGAGCGTCATGGTCCTCGTCCGACCAGGTCTGGCACCTGACTGTCGAATCG
CCAGAGGACACAAGCATCTACCGCTCCCGGTTCTTGATCCTGGGCACTGGGTTCTACAACTACAGTCAGGCCCTC
AAGACCGAGATCCCAGGGTTACAACAGTTTCAAGGGACGGTGGTGCATCCTCAATTCTGGCCTGACGGACTGGAT
TACCGTGACCAGAAGATCGTCGTAATTGGTAGCGGCGCGACCGCAATCACCATGATCCCCAAGCTGGCCGAGAAG
GCAGCGCATACGACGATGCTGCAGCGCAGTCCGACCTACATCGTGTCGATGCCGAACCGGCAGATACCCAGTGCG
TCTTCCTGGTTGGCACGCTGGCTGCCTCGTCCCCGTTTCTACTGGGTGCAGCGCTTCCTGTCGCTCGTGTACACG
CGGCTCTTCATCCTCTTTTGCGAGCGATGGCCGCAATTAGCCCGCGCCTATCTGCGGTCTCACGTCCGACGCCAG
TTACCCCCGGCGGTGGCCTACGACCCGCACTTTGCGCCGCTCTATGCGCCGATGGAGCAGCGGCTGTGCGTGAGC
CCAGACGCTGACTTCTTCCGCAGCTTGCATACAGGTCACGTCGGCGTGGTCACGGACACGATCGAGACCTGCACG
ACCACCGGGATCCAGCTGCGGTCCGGACAGCATCTTGACGCCGATTTGATTATTACCGCCACGGGGCTCCAGATG
CAATTTGCCGGAGGAGCCCTGCTTGATATCGATGGCGTGTCGGTGGATCTGTCGTCAAAATTCATCTGGAACGGC
ATGATGCTACAGGACGTCCCCAATGCGGTCGTGGTCAATGGATATACCAACGCGTCGTGGACCTTGGGCGCCGAC
GCAACCATGATTGCGGTCTGCCGGTTGATTAAACTCCTTCAAGCCCGCGGACACACCGTCGCTGTGCCACGCGTA
GATCCCCAGGGGCCGCCCCTCACTCCACGGCCCACATTTGCCCTGACATCGACGTATATCCACGCCGCGGCGCGC
TTTATGCCGCGCGTAGCCGCAGAGAAGCCCTGGCAACGACGGGATAACTATTTCACCGATCTGTGGTTTGCCAAG
TATGGCGACTTGGAACAGGGGCTCGAGTTCATCCCCGGCAGCGGGTTCAGGAAGCCCGCAAAAGGAGGCGGAGAG
ACACCGAAGGAGGTGAAGCGGGATTAG
Transcript >Ani_SJS100_1|g5934.t1
ATGGCTTCACCTGCAGTTGACTACGATGTCCTCATCGTTGGAGCCGGCATTTCTGGCATTAACGCGGCCTACCGG
CTTCAGACCGAACTGCCCGATCTCACCTTCACTATCCTCGAGGGGCGGGCCACATTAGGGGGCACTTGGGATTTC
TTTCGCTATCCTGGCATCCGATCGGATTCGGACCTGTTCACCTTTTGCTTTCCCTGGCACCCATGGGAGCAAGCA
TATCCCATCGCCGAGGGCGCGACCATTCTACAGTATATCCAACAGGCTGCCTCGAAGCATGGCATCGACCGTCGG
ATTGAATTTCAGCACCGGGTGACAAGAGCGTCATGGTCCTCGTCCGACCAGGTCTGGCACCTGACTGTCGAATCG
CCAGAGGACACAAGCATCTACCGCTCCCGGTTCTTGATCCTGGGCACTGGGTTCTACAACTACAGTCAGGCCCTC
AAGACCGAGATCCCAGGGTTACAACAGTTTCAAGGGACGGTGGTGCATCCTCAATTCTGGCCTGACGGACTGGAT
TACCGTGACCAGAAGATCGTCGTAATTGGTAGCGGCGCGACCGCAATCACCATGATCCCCAAGCTGGCCGAGAAG
GCAGCGCATACGACGATGCTGCAGCGCAGTCCGACCTACATCGTGTCGATGCCGAACCGGCAGATACCCAGTGCG
TCTTCCTGGTTGGCACGCTGGCTGCCTCGTCCCCGTTTCTACTGGGTGCAGCGCTTCCTGTCGCTCGTGTACACG
CGGCTCTTCATCCTCTTTTGCGAGCGATGGCCGCAATTAGCCCGCGCCTATCTGCGGTCTCACGTCCGACGCCAG
TTACCCCCGGCGGTGGCCTACGACCCGCACTTTGCGCCGCTCTATGCGCCGATGGAGCAGCGGCTGTGCGTGAGC
CCAGACGCTGACTTCTTCCGCAGCTTGCATACAGGTCACGTCGGCGTGGTCACGGACACGATCGAGACCTGCACG
ACCACCGGGATCCAGCTGCGGTCCGGACAGCATCTTGACGCCGATTTGATTATTACCGCCACGGGGCTCCAGATG
CAATTTGCCGGAGGAGCCCTGCTTGATATCGATGGCGTGTCGGTGGATCTGTCGTCAAAATTCATCTGGAACGGC
ATGATGCTACAGGACGTCCCCAATGCGGTCGTGGTCAATGGATATACCAACGCGTCGTGGACCTTGGGCGCCGAC
GCAACCATGATTGCGGTCTGCCGGTTGATTAAACTCCTTCAAGCCCGCGGACACACCGTCGCTGTGCCACGCGTA
GATCCCCAGGGGCCGCCCCTCACTCCACGGCCCACATTTGCCCTGACATCGACGTATATCCACGCCGCGGCGCGC
TTTATGCCGCGCGTAGCCGCAGAGAAGCCCTGGCAACGACGGGATAACTATTTCACCGATCTGTGGTTTGCCAAG
TATGGCGACTTGGAACAGGGGCTCGAGTTCATCCCCGGCAGCGGGTTCAGGAAGCCCGCAAAAGGAGGCGGAGAG
ACACCGAAGGAGGTGAAGCGGGATTAG
Gene >Ani_SJS100_1|g5934.t1
ATGGCTTCACCTGCAGTTGACTACGATGTCCTCATCGTTGGAGCCGGCATTTCTGGCATTAACGCGGCCTACCGG
CTTCAGACCGAACTGCCCGATCTCACCTTCACTATCCTCGAGGGGCGGGCCACATTAGGGGGCACTTGGGATTTC
TTTCGCTATCCTGGCATCCGATCGGATTCGGACCTGTTCACCTTTTGCTTTCCCTGGCACCCATGGGAGCAAGCA
TATCCCATCGCCGAGGGCGCGACCATTCTACAGTATATCCAACAGGCTGCCTCGAAGCATGGCATCGACCGTCGG
ATTGAATTTCAGCACCGGGTGACAAGAGCGTCATGGTCCTCGTCCGACCAGGTCTGGCACCTGACTGTCGAATCG
CCAGAGGACACAAGCATCTACCGCTCCCGGTTCTTGATCCTGGGCACTGGGTTCTACAACTACAGTCAGGCCCTC
AAGACCGAGATCCCAGGGTTACAACAGTTTCAAGGGACGGTGGTGCATCCTCAATTCTGGCCTGACGGACTGGAT
TACCGTGACCAGAAGATCGTCGTAATTGGTAGCGGCGCGACCGCAATCACCATGATCCCCAAGCTGGCCGAGAAG
GCAGCGCATACGACGATGCTGCAGCGCAGTCCGACCTACATCGTGTCGATGCCGAACCGGCAGATACCCAGTGCG
TCTTCCTGGTTGGCACGCTGGCTGCCTCGTCCCCGTTTCTACTGGGTGCAGCGCTTCCTGTCGCTCGTGTACACG
CGGCTCTTCATCCTCTTTTGCGAGCGATGGCCGCAATTAGCCCGCGCCTATCTGCGGTCTCACGTCCGACGCCAG
TTACCCCCGGCGGTGGCCTACGACCCGCACTTTGCGCCGCTCTATGCGCCGATGGAGCAGCGGCTGTGCGTGAGC
CCAGACGCTGACTTCTTCCGCAGCTTGCATACAGGTCACGTCGGCGTGGTCACGGACACGATCGAGACCTGCACG
ACCACCGGGATCCAGCTGCGGTCCGGACAGCATCTTGACGCCGATTTGATTATTACCGCCACGGGGCTCCAGATG
CAATTTGCCGGAGGAGCCCTGCTTGATATCGATGGCGTGTCGGTGGATCTGTCGTCAAAATTCATCTGGAACGGC
ATGATGCTACAGGACGTCCCCAATGCGGTCGTGGTCAATGGATATACCAACGCGTCGTGGACCTTGGGCGCCGAC
GCAACCATGATTGCGGTCTGCCGGTTGATTAAACTCCTTCAAGCCCGCGGACACACCGTCGCTGTGCCACGCGTA
GATCCCCAGGGGCCGCCCCTCACTCCACGGCCCACATTTGCCCTGACATCGACGTATATCCACGCCGCGGCGCGC
TTTATGCCGCGCGTAGCCGCAGAGAAGCCCTGGCAACGACGGGATAACTATTTCACCGATCTGTGGTTTGCCAAG
TATGGCGACTTGGAACAGGGGCTCGAGTTCATCCCCGGCAGCGGGTTCAGGAAGCCCGCAAAAGGAGGCGGAGAG
ACACCGAAGGAGGTGAAGCGGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail