Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g591.t1
Gene name
Locationscaffold_002:429587..432694
Strand+
Gene length (bp)3107
Transcript length (bp)2709
Coding sequence length (bp)2709
Protein length (aa) 903

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.8E-55 10 431
PF00975 Thioesterase Thioesterase domain 2.4E-14 691 891
PF00550 PP-binding Phosphopantetheine attachment site 6.3E-09 571 635

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g591.t1
MAPGILTYLEQAAEYSPSKGFVFYSVGKDQPETILYPDFWRLVKRNAQTLVEKKVAVPDRVLLVHFDTHKENIIW
FWSVIAAGCVPAVSTPLAVDPVARERHLTHLQRLLERPNVLTSVKHTDDLSIIDDSQKFFIEDLASNADQSADYQ
PASPSSDLALLLLTSGSTGNAKAVMLHHSQIFAAIEAKWKALSSTPDNVFLNWIGFDHVACFMEMHMHALSRGCH
QIHLPAVTVLENPLLYLEKIAEYSVTNAFAPNFLVALVGKAIEAQQERDPRALDLDLSHLRIVLSGGEANLTSTS
IIFNRKLVEMGAAKNVLHPSFGMTETCAGIHYHYSFPELEQKAKLQFCSVGQTTPTLQMRITDENGETVRSGENG
NLELYGPMVFKGYYNDDKNTKAAFTEDGWFKTGDTGYIDNRDNLVLSGRSKDSIIINGINFYSHELENAIDSAGL
EGLVPSYTVVVSSWLENADSEDIIVLYLSSQKGTEDDRTFLETLNSISRITALYCSKQPVDIIPLPVELLPKNSL
GKLPRTKLKQQYEEGRFSTYRDLAAQRASSYRARSKRAPQNDMEETLAGIFADEFGLDMSEVGVDDSLYDMGVNS
VRLIRYKRIVETRLGLNEEIPMITILQNPTIEALAVMLQDLRKGPKPYNPIVQLQDGPSKAPPIFFFHPGMGEVL
VFLNFSKYFADRKVVYLKSIRELQPEGPYIFIGYSYGAMIAFETAKKVEASGDRVGFLGSLNLPPHIKKHIREMD
YAESLLHLVYFLGFITEEDAHRMSPDMHKLPQSEVLPAIMKVSDKERVQELAMDEGKIRDWAMLSSKLQELAHTY
DPSGTVQAMDVFYAIPLLSVGRDKDVWLKQHLMRWKEHSKSVRFHDVPGSHHTMMAEENVFALHKILRAALNERG
ML*
Coding >Ani_SJS100_1|g591.t1
ATGGCGCCTGGAATCCTGACATATCTGGAGCAGGCGGCCGAGTATTCGCCGTCTAAAGGCTTCGTCTTCTATAGT
GTTGGTAAGGACCAACCGGAGACAATCCTTTACCCCGATTTTTGGCGCCTCGTCAAGCGTAATGCTCAAACTTTA
GTTGAAAAGAAAGTCGCGGTGCCTGACCGGGTTCTCCTGGTCCATTTTGACACTCACAAAGAGAACATCATATGG
TTTTGGTCTGTCATTGCAGCCGGATGCGTTCCAGCTGTGTCTACTCCCCTAGCTGTAGACCCAGTGGCACGAGAA
CGGCATCTAACCCACCTTCAGAGGCTCCTAGAGAGACCCAATGTCCTCACCAGTGTGAAGCATACAGATGACCTG
AGTATCATTGATGACTCTCAAAAGTTTTTCATCGAGGATCTGGCCTCGAATGCAGATCAATCTGCAGATTATCAA
CCTGCGAGCCCTTCGTCAGACCTTGCGCTGCTACTGCTCACCTCCGGCAGTACGGGTAATGCCAAAGCGGTGATG
CTGCACCACTCTCAAATATTCGCCGCGATTGAAGCCAAGTGGAAGGCACTTTCAAGCACTCCGGACAACGTCTTT
TTGAACTGGATTGGGTTTGATCATGTTGCCTGCTTCATGGAGATGCACATGCACGCGTTATCCAGGGGCTGCCAT
CAGATTCATCTCCCAGCCGTGACGGTTCTGGAGAACCCCCTTCTTTATCTGGAGAAGATAGCAGAATATTCTGTC
ACGAACGCTTTCGCCCCCAATTTCCTTGTGGCCCTGGTAGGGAAGGCCATCGAGGCCCAACAGGAGCGGGATCCT
CGTGCACTTGATCTGGACTTGAGTCACTTGCGCATAGTGCTCTCAGGTGGTGAAGCCAATCTCACATCGACGAGC
ATCATATTCAACCGTAAGTTGGTCGAGATGGGAGCCGCCAAGAATGTCCTCCATCCGTCCTTCGGTATGACAGAG
ACTTGTGCAGGCATCCACTATCACTACAGCTTCCCCGAACTTGAGCAGAAGGCTAAGCTGCAATTCTGCTCTGTG
GGGCAGACAACGCCCACTCTGCAGATGCGAATCACCGATGAAAATGGGGAAACGGTGAGAAGTGGCGAGAATGGA
AACCTGGAGTTGTATGGGCCGATGGTCTTCAAGGGCTATTACAACGACGACAAGAACACCAAGGCTGCCTTTACC
GAGGACGGCTGGTTTAAGACTGGTGACACTGGATACATCGATAACAGGGATAATCTTGTGCTCTCCGGACGGTCC
AAGGACAGTATCATCATCAATGGGATCAACTTTTATTCTCATGAACTGGAGAATGCCATAGACTCAGCCGGGCTG
GAAGGGCTTGTCCCATCGTATACGGTGGTGGTCTCATCCTGGCTTGAAAATGCAGACAGTGAAGATATCATTGTC
CTATACCTTTCGAGCCAGAAAGGCACTGAAGACGACAGAACCTTCCTCGAAACTCTTAATTCGATATCCAGAATA
ACTGCTCTCTACTGCTCCAAGCAGCCAGTGGATATCATACCACTCCCAGTAGAGCTGCTTCCCAAAAATTCTCTG
GGAAAGCTCCCTCGCACAAAGCTCAAGCAGCAGTATGAAGAAGGTCGTTTCAGCACATACAGAGATCTTGCCGCA
CAAAGAGCTTCTTCGTATCGTGCGCGATCCAAGCGTGCCCCGCAGAACGACATGGAAGAGACGCTTGCTGGGATT
TTTGCAGACGAATTCGGCCTTGATATGTCCGAAGTTGGTGTGGACGACAGTCTTTATGACATGGGAGTGAATAGC
GTCCGGTTGATTCGATACAAGAGGATCGTGGAGACTCGTCTCGGCCTAAACGAAGAAATTCCAATGATCACGATC
CTGCAAAACCCGACTATTGAAGCATTGGCAGTTATGCTTCAGGATCTTCGGAAAGGTCCCAAGCCATATAACCCG
ATTGTGCAGCTGCAGGACGGCCCATCAAAGGCTCCTCCGATCTTCTTCTTCCATCCCGGAATGGGCGAAGTCCTT
GTGTTCCTCAACTTCAGCAAGTACTTTGCTGACCGAAAAGTTGTCTACCTCAAGTCCATCCGAGAGCTTCAGCCG
GAAGGACCGTACATTTTCATCGGGTATTCGTACGGTGCCATGATTGCTTTCGAAACCGCCAAAAAGGTCGAGGCT
TCTGGCGATAGAGTCGGCTTCCTCGGTAGTCTGAACCTTCCGCCACATATCAAGAAACATATCCGAGAGATGGAT
TATGCCGAGTCGCTGCTTCATCTCGTATACTTCCTCGGTTTCATTACCGAAGAGGATGCCCATCGTATGTCTCCT
GATATGCACAAGCTCCCCCAAAGCGAGGTCCTTCCAGCCATCATGAAAGTCTCGGATAAAGAGCGCGTCCAGGAG
CTGGCCATGGACGAAGGGAAGATCCGAGACTGGGCGATGTTGTCGTCCAAGCTCCAGGAGCTAGCCCATACATAT
GATCCTTCTGGAACTGTGCAGGCGATGGATGTTTTCTACGCCATCCCGCTGCTTTCTGTTGGTCGAGACAAGGAT
GTCTGGCTCAAACAGCACCTCATGAGGTGGAAAGAGCATTCCAAGTCGGTTAGATTCCACGATGTTCCTGGCTCC
CATCATACGATGATGGCAGAAGAGAATGTCTTTGCATTGCATAAGATTCTCCGGGCCGCATTGAACGAGCGCGGA
ATGCTTTGA
Transcript >Ani_SJS100_1|g591.t1
ATGGCGCCTGGAATCCTGACATATCTGGAGCAGGCGGCCGAGTATTCGCCGTCTAAAGGCTTCGTCTTCTATAGT
GTTGGTAAGGACCAACCGGAGACAATCCTTTACCCCGATTTTTGGCGCCTCGTCAAGCGTAATGCTCAAACTTTA
GTTGAAAAGAAAGTCGCGGTGCCTGACCGGGTTCTCCTGGTCCATTTTGACACTCACAAAGAGAACATCATATGG
TTTTGGTCTGTCATTGCAGCCGGATGCGTTCCAGCTGTGTCTACTCCCCTAGCTGTAGACCCAGTGGCACGAGAA
CGGCATCTAACCCACCTTCAGAGGCTCCTAGAGAGACCCAATGTCCTCACCAGTGTGAAGCATACAGATGACCTG
AGTATCATTGATGACTCTCAAAAGTTTTTCATCGAGGATCTGGCCTCGAATGCAGATCAATCTGCAGATTATCAA
CCTGCGAGCCCTTCGTCAGACCTTGCGCTGCTACTGCTCACCTCCGGCAGTACGGGTAATGCCAAAGCGGTGATG
CTGCACCACTCTCAAATATTCGCCGCGATTGAAGCCAAGTGGAAGGCACTTTCAAGCACTCCGGACAACGTCTTT
TTGAACTGGATTGGGTTTGATCATGTTGCCTGCTTCATGGAGATGCACATGCACGCGTTATCCAGGGGCTGCCAT
CAGATTCATCTCCCAGCCGTGACGGTTCTGGAGAACCCCCTTCTTTATCTGGAGAAGATAGCAGAATATTCTGTC
ACGAACGCTTTCGCCCCCAATTTCCTTGTGGCCCTGGTAGGGAAGGCCATCGAGGCCCAACAGGAGCGGGATCCT
CGTGCACTTGATCTGGACTTGAGTCACTTGCGCATAGTGCTCTCAGGTGGTGAAGCCAATCTCACATCGACGAGC
ATCATATTCAACCGTAAGTTGGTCGAGATGGGAGCCGCCAAGAATGTCCTCCATCCGTCCTTCGGTATGACAGAG
ACTTGTGCAGGCATCCACTATCACTACAGCTTCCCCGAACTTGAGCAGAAGGCTAAGCTGCAATTCTGCTCTGTG
GGGCAGACAACGCCCACTCTGCAGATGCGAATCACCGATGAAAATGGGGAAACGGTGAGAAGTGGCGAGAATGGA
AACCTGGAGTTGTATGGGCCGATGGTCTTCAAGGGCTATTACAACGACGACAAGAACACCAAGGCTGCCTTTACC
GAGGACGGCTGGTTTAAGACTGGTGACACTGGATACATCGATAACAGGGATAATCTTGTGCTCTCCGGACGGTCC
AAGGACAGTATCATCATCAATGGGATCAACTTTTATTCTCATGAACTGGAGAATGCCATAGACTCAGCCGGGCTG
GAAGGGCTTGTCCCATCGTATACGGTGGTGGTCTCATCCTGGCTTGAAAATGCAGACAGTGAAGATATCATTGTC
CTATACCTTTCGAGCCAGAAAGGCACTGAAGACGACAGAACCTTCCTCGAAACTCTTAATTCGATATCCAGAATA
ACTGCTCTCTACTGCTCCAAGCAGCCAGTGGATATCATACCACTCCCAGTAGAGCTGCTTCCCAAAAATTCTCTG
GGAAAGCTCCCTCGCACAAAGCTCAAGCAGCAGTATGAAGAAGGTCGTTTCAGCACATACAGAGATCTTGCCGCA
CAAAGAGCTTCTTCGTATCGTGCGCGATCCAAGCGTGCCCCGCAGAACGACATGGAAGAGACGCTTGCTGGGATT
TTTGCAGACGAATTCGGCCTTGATATGTCCGAAGTTGGTGTGGACGACAGTCTTTATGACATGGGAGTGAATAGC
GTCCGGTTGATTCGATACAAGAGGATCGTGGAGACTCGTCTCGGCCTAAACGAAGAAATTCCAATGATCACGATC
CTGCAAAACCCGACTATTGAAGCATTGGCAGTTATGCTTCAGGATCTTCGGAAAGGTCCCAAGCCATATAACCCG
ATTGTGCAGCTGCAGGACGGCCCATCAAAGGCTCCTCCGATCTTCTTCTTCCATCCCGGAATGGGCGAAGTCCTT
GTGTTCCTCAACTTCAGCAAGTACTTTGCTGACCGAAAAGTTGTCTACCTCAAGTCCATCCGAGAGCTTCAGCCG
GAAGGACCGTACATTTTCATCGGGTATTCGTACGGTGCCATGATTGCTTTCGAAACCGCCAAAAAGGTCGAGGCT
TCTGGCGATAGAGTCGGCTTCCTCGGTAGTCTGAACCTTCCGCCACATATCAAGAAACATATCCGAGAGATGGAT
TATGCCGAGTCGCTGCTTCATCTCGTATACTTCCTCGGTTTCATTACCGAAGAGGATGCCCATCGTATGTCTCCT
GATATGCACAAGCTCCCCCAAAGCGAGGTCCTTCCAGCCATCATGAAAGTCTCGGATAAAGAGCGCGTCCAGGAG
CTGGCCATGGACGAAGGGAAGATCCGAGACTGGGCGATGTTGTCGTCCAAGCTCCAGGAGCTAGCCCATACATAT
GATCCTTCTGGAACTGTGCAGGCGATGGATGTTTTCTACGCCATCCCGCTGCTTTCTGTTGGTCGAGACAAGGAT
GTCTGGCTCAAACAGCACCTCATGAGGTGGAAAGAGCATTCCAAGTCGGTTAGATTCCACGATGTTCCTGGCTCC
CATCATACGATGATGGCAGAAGAGAATGTCTTTGCATTGCATAAGATTCTCCGGGCCGCATTGAACGAGCGCGGA
ATGCTTTGA
Gene >Ani_SJS100_1|g591.t1
ATGGCGCCTGGAATCCTGACATATCTGGAGCAGGCGGCCGAGTATTCGCCGTCTAAAGGCTTCGTCTTCTATAGT
GTTGGTAAGGACCAACCGGAGACAATCCTTTACCCCGATTTTTGGCGCCTCGTCAAGGTAACATCCACCCGCATC
AGTACCATGAGTCCCAGCAGGTGGTTTCATGTTTGCTTTGCTGACCGCATAATTCTCAGCGTAATGCTCAAACTT
TAGTTGAAAAGAAAGTCGCGGTGCCTGACCGGGTTCTCCTGGTCCATTTTGACACTCACAAAGAGAACATCATAT
GGTTTTGGTCTGTCATTGCAGCCGGATGCGTTCCAGCTGTGTCTACTCCCCTAGCTGTAGACCCAGTGGCACGAG
AACGGCATCTAACCCACCTTCAGAGGCTCCTAGAGAGACCCAATGTCCTCACCAGTGTGAAGCATACAGATGACC
TGAGTATCATTGATGACTCTCAAAAGTTTTTCATCGAGGATCTGGCCTCGAATGCAGATCAATCTGCAGATTATC
AACCTGCGAGCCCTTCGTCAGACCTTGCGCTGCTACTGCTCACCTCCGGCAGTACGGGTAATGCCAAAGCGGTGA
TGCTGCACCACTCTCAAATATTCGCCGCGATTGAAGCCAAGTGGAAGGCACTTTCAAGCACTCCGGACAACGTCT
TTTTGAACTGGATTGGTAAAAATGCCTCTCAATTGTGACTCTCCAACCCTATGAGGCGCGGCTAACATATCGTCG
TAGGGTTTGATCATGTTGCCTGCTTCATGGAGATGCACATGCACGCGTTATCCAGGGGCTGCCATCAGATTCATC
TCCCAGCCGTGACGGTTCTGGAGAACCCCCTTCTTTATCTGGAGAAGATAGCAGAATATTCTGTCACGAACGCTT
TCGCCCCCAATTTCCTTGTGGCCCTGGTAGGGAAGGCCATCGAGGCCCAACAGGAGCGGGATCCTCGTGCACTTG
ATCTGGACTTGAGTCACTTGCGCATAGTGCTCTCAGGTGGTGAAGCCAATCTCACATCGACGAGCATCATATTCA
ACCGTAAGTTGGTCGAGATGGGAGCCGCCAAGAATGTCCTCCATCCGTCCTTCGGTATGACAGAGGTAAGCGGCG
CTGTATAAGATATGCAAGTGGCGGACCTGGCCCACTAATACTGTTGAGCTTTGGTAGACTTGTGCAGGCATCCAC
TATCACTACAGCTTCCCCGAACTTGAGCAGAAGGCTAAGCTGCAATTCTGCTCTGTGGGGCAGACAACGCCCACT
CTGCAGATGCGAATCACCGATGAAAATGGGGAAACGGTGAGAAGTGGCGAGAATGGAAACCTGGAGTTGTATGGG
CCGATGGTCTTCAAGGGCTATTACAACGACGACAAGAACACCAAGGCTGCCTTTACCGAGGACGGCTGGTTTAAG
ACTGGTGACACTGGATACATCGATAACAGGGATAATCTTGTGCTCTCCGGACGGTCCAAGGACAGTATCATCATC
AATGGGATCAACTTTTATTCTCATGAACTGGAGAATGCCATAGACTCAGCCGGGCTGGAAGGGCTTGTCCCATCG
TATACGGTGGTGGTCTCATCCTGGCTTGAAAATGCAGACAGTGAAGATATCATTGTCCTATACCTTTCGAGCCAG
AAAGGCACTGAAGACGACAGAACCTTCCTCGAAACTCTTAATTCGATATCCAGAATAACTGCTCTCTACTGCTCC
AAGCAGCCAGTGGATATCATACCACTCCCAGTAGAGCTGCTTCCCAAAAATTCTCTGGGAAAGCTCCCTCGCACA
AAGCTCAAGCAGCAGTATGAAGAAGGTCGTTTCAGCACATACAGAGATCTTGCCGCACAAAGAGCTTCTTCGTAT
CGTGCGCGATCCAAGCGTGCCCCGCAGAACGACATGGAAGAGACGCTTGCTGGGATTTTTGCAGACGAATTCGGC
CTTGATATGTCCGAAGTTGGTGTGGACGACAGTCTTTATGACATGGGAGTGAATAGCGTCCGGTTGATTCGATAC
AAGAGGATCGTGGAGACTCGTCTCGGCCTAAACGAAGAAATTCCAATGATCACGATCCTGCAAAACCCGACTATT
GAAGCATTGGCAGTTATGCTTCAGGATCTTCGGAAAGGTCCCAAGCCATATAACCCGATTGTGCAGCTGCAGGAC
GGCCCATCAAAGGCTCCTCCGATCTTCTTCTTCCATCCCGGAATGGGCGAAGTCCTTGTGTTCCTCAACTTCAGC
AAGTACTTTGCTGACCGAAAAGTGTACGCTTTTCGAGCCCCAGGTTTTAATCCAGGTGAAAAGATGTTTACCACT
ATCGACGAGATGACAGAGTAGGACCCTTGGAAACCGCCCCGTCATAGAAGCCTCATAGCTGATGAACGTACTAGT
GTCTACCTCAAGTCCATCCGAGAGCTTCAGCCGGAAGGACCGTACATTTTCATCGGGTATTCGTACGGTGCCATG
ATTGCTTTCGAAACCGCCAAAAAGGTCGAGGCTTCTGGCGATAGAGTCGGCTTCCTCGGTAGTCTGAACCTTCCG
CCACATATCAAGAAACATATCCGAGAGATGGATTATGCCGAGTCGCTGCTTCATCTCGTATACTTCCTCGGTTTC
ATTACCGAAGAGGATGCCCATCGTATGTCTCCTGATATGCACAAGGTGAGTCATTTTTATAAGAGGTAATATGTT
GTTCGAGTAAGACTCTTGTTAATCATCACTTCTAGCTCCCCCAAAGCGAGGTCCTTCCAGCCATCATGAAAGTCT
CGGATAAAGAGCGCGTCCAGGAGCTGGCCATGGACGAAGGGAAGATCCGAGACTGGGCGATGTTGTCGTCCAAGC
TCCAGGAGCTAGCCCATACATATGATCCTTCTGGAACTGTGCAGGCGATGGATGTTTTCTACGCCATCCCGCTGC
TTTCTGTTGGTCGAGACAAGGATGTCTGGCTCAAACAGCACCTCATGAGGTGGAAAGAGCATTCCAAGTCGGTTA
GATTCCACGATGTTCCTGGCTCCCATCATACGATGATGGCAGAAGAGAATGTCTTTGCATTGCATAAGATTCTCC
GGGCCGCATTGAACGAGCGCGGAATGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail