Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5906.t1
Gene name
Locationscaffold_034:219101..223647
Strand+
Gene length (bp)4546
Transcript length (bp)3204
Coding sequence length (bp)3204
Protein length (aa) 1068

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 2.7E-98 27 476
PF07690 MFS_1 Major Facilitator Superfamily 6.0E-21 591 991

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 72 94 22
3 115 134 19
4 163 185 22
5 192 214 22
6 229 251 22
7 271 293 22
8 323 345 22
9 357 379 22
10 384 406 22
11 435 457 22
12 472 494 22
13 590 612 22
14 627 649 22
15 656 673 17
16 683 705 22
17 717 739 22
18 749 767 18
19 818 840 22
20 868 890 22
21 911 933 22
22 943 965 22
23 972 994 22
24 1004 1026 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5906.t1
MTLLQSLEVPQEGETIPDRWINSDIEPIQADRRRWGFWTFNNYWVLISSNISGYMTGSSLIALGLSWWQAIVAIV
IGNILATIFIVLNSLPGAFYHIGFPVVNRYVWGMYGSQFVIWNRIFLSLIWYAFQAWIGGECVYVCLQAIWPSLE
KRIPNHMPADTGMTTAEFVGYIIFMVLSLPVIYVRPHKLQKMFYISAAIVIVFEFVLLIWSLATMGPDGFGDTLA
SGSHVSGWMIAYGIISTIGSICAGILNQNDYARFARRPRDAIYGQIFSAALYAIICGIIGILVTAATQERYGEAY
WNLPKLLGAVIETGGPRSRAAGFFGGIALIISQMGVNVPGNALSGGFDLAATFPRYINIRRGAYLTALVSIAANP
WRLVNTATVFITVLSSYSVFMAPMIGMMIASYLCVHQRKIKVPDLFVGDARSIYWYTSGVNWRAIVAWICGTVPS
LPGFIAYVNSTIHVPAGLMHLYYICFLSGALIAGAVFVALHYVFPDRRVRSFLASAPTSQMLIEEYRDQQISVEA
VICERPPKLSDDEFKTPRTMTEEGIKTSSEGERPGQSPPGIVLVPRPSSHPQDPLNWSHRRKQIILATLCLASFS
GAIAPLSGQLNLAQQAKIYGKTRVQESYANSAALAGMAFGPFFFAPVAHRLGRSSVIFWCILCALICQIWGAVMT
HSDDYIPYIISRLFAGFFGAVPTVLGPRVITDLLFLHQRGRAFMALHMAFLFGTIAGPTFSAFISANAFFPVEFW
WTVGLLGATAILIFLFLEETGFDRENLDRNPAIPTNWLANRCATFFFGQRVVQPTIWSVTMKIAVAPVLIGICPV
TVIMGTFTLISFGFYVGMNALVPVWLQRTPEEGGYGFSLKQNAAFTFCHWIGILVVQIVGHYYNDRLPLALARRF
NHGAWKPEYRLQVLWIPSLILNPIGLGLFGATLQYHLHYMVLALAVFIVTIGSLASVPVTVNYVVECFTRYPAEA
GIVIGAYRIVYGLTISFYIDPWVAAVDVGWVYGMMAFFAIFSFLFVMLLMWKGHAIREWQLASVASSEEGVQVED
GSSEKGVVEHDGEKLKV*
Coding >Ani_SJS100_1|g5906.t1
ATGACGCTCCTCCAGTCGCTCGAGGTGCCTCAGGAAGGAGAGACCATCCCCGACCGATGGATTAATAGTGACATT
GAACCCATCCAGGCGGATCGTCGCCGCTGGGGCTTTTGGACCTTTAACAACTACTGGGTCCTCATAAGCTCCAAC
ATCTCTGGCTACATGACCGGCAGCTCACTCATCGCCCTGGGACTGTCTTGGTGGCAGGCTATCGTCGCCATTGTG
ATCGGAAACATTCTGGCGACCATTTTTATCGTCCTCAACTCGCTGCCTGGGGCGTTTTATCATATTGGATTTCCT
GTGGTGAATCGATATGTCTGGGGCATGTATGGCAGCCAGTTTGTCATCTGGAACCGCATCTTTCTCTCTCTCATT
TGGTATGCCTTCCAGGCTTGGATTGGAGGCGAGTGTGTCTATGTCTGTCTGCAAGCCATTTGGCCCTCGCTGGAG
AAGCGCATCCCCAACCACATGCCCGCCGACACCGGTATGACGACCGCCGAATTTGTGGGGTACATCATCTTCATG
GTCCTCTCGCTTCCCGTCATCTATGTGCGACCGCATAAGCTGCAGAAAATGTTCTACATCTCTGCTGCCATTGTC
ATTGTTTTCGAATTCGTGCTCCTAATTTGGTCTCTGGCCACCATGGGTCCCGACGGCTTCGGTGACACACTAGCT
TCCGGGTCGCATGTCTCTGGGTGGATGATCGCGTATGGGATTATCAGCACGATCGGCAGCATCTGCGCCGGAATC
CTGAACCAGAACGATTACGCGCGGTTTGCACGACGACCCCGAGATGCCATCTATGGTCAAATCTTTAGTGCAGCA
CTGTACGCCATCATCTGCGGCATCATCGGCATTCTCGTCACGGCCGCCACGCAGGAGCGCTATGGAGAAGCCTAC
TGGAATCTTCCCAAGCTCCTGGGTGCAGTCATTGAGACTGGTGGTCCGCGATCGCGCGCGGCGGGCTTCTTCGGA
GGTATCGCGCTGATCATCTCGCAGATGGGGGTAAATGTGCCGGGCAACGCTTTGTCTGGAGGGTTCGATCTGGCG
GCGACCTTCCCCAGGTACATCAACATCCGTCGGGGCGCGTACCTGACGGCATTAGTCTCCATTGCAGCCAATCCC
TGGAGATTGGTCAACACGGCCACGGTCTTCATCACGGTCCTCAGTAGCTACTCGGTGTTCATGGCGCCGATGATC
GGGATGATGATCGCCTCGTACCTGTGCGTCCACCAGCGCAAGATCAAGGTCCCAGATCTCTTTGTAGGAGATGCA
CGGAGCATCTACTGGTATACATCCGGGGTGAATTGGCGGGCCATCGTCGCGTGGATTTGTGGGACAGTCCCCTCG
CTTCCCGGCTTCATAGCCTACGTCAACTCAACCATTCATGTTCCGGCCGGGCTGATGCATCTCTACTACATCTGC
TTCCTCAGCGGCGCGTTGATTGCCGGCGCCGTATTTGTGGCACTGCATTATGTCTTTCCCGACCGACGTGTGCGA
TCGTTCCTCGCGTCGGCGCCTACATCCCAGATGCTGATCGAGGAATACCGGGACCAGCAGATCTCAGTCGAAGCG
GTGATTTGTGAAAGGCCTCCGAAACTGTCGGACGATGAATTCAAGACACCCAGAACAATGACGGAGGAAGGTATC
AAAACCAGCAGTGAGGGCGAACGCCCTGGCCAGTCCCCGCCAGGGATCGTGCTGGTGCCTCGACCCAGTTCCCAT
CCTCAGGACCCGCTCAACTGGTCGCATCGTCGGAAACAAATCATCCTGGCCACTCTCTGCCTGGCCTCATTCTCG
GGGGCTATCGCTCCCCTATCGGGCCAGCTGAATCTGGCCCAGCAGGCCAAGATCTATGGCAAAACTCGCGTCCAA
GAGTCCTATGCTAACTCCGCTGCATTGGCGGGCATGGCCTTCGGGCCCTTTTTCTTCGCTCCCGTCGCCCACCGG
CTGGGTCGCAGCTCCGTTATTTTCTGGTGCATTCTCTGCGCCCTCATCTGTCAGATCTGGGGAGCCGTCATGACT
CATTCGGATGATTACATTCCCTACATCATCTCGCGACTATTTGCCGGCTTTTTCGGCGCCGTGCCCACCGTCCTG
GGCCCGCGTGTCATCACCGACCTGCTGTTCCTGCATCAGCGCGGTCGCGCCTTCATGGCCCTGCATATGGCCTTC
TTGTTTGGCACCATCGCCGGCCCGACCTTCTCGGCCTTCATCTCGGCCAATGCTTTCTTCCCCGTCGAGTTCTGG
TGGACCGTCGGCCTGTTGGGAGCCACGGCCATCCTCATCTTCCTCTTCCTCGAGGAGACGGGCTTTGACCGCGAG
AACCTTGACCGGAATCCTGCCATCCCGACTAACTGGCTGGCCAACCGCTGCGCTACCTTCTTTTTCGGCCAACGT
GTGGTGCAGCCCACCATCTGGTCGGTGACCATGAAAATTGCCGTGGCGCCCGTACTGATCGGAATCTGTCCGGTC
ACGGTCATCATGGGTACCTTCACTCTCATTTCCTTCGGCTTCTACGTCGGCATGAACGCTCTGGTGCCCGTGTGG
CTGCAGCGGACTCCAGAGGAGGGAGGTTACGGCTTCTCCCTGAAGCAAAATGCCGCCTTCACCTTCTGTCACTGG
ATCGGCATCCTCGTCGTCCAAATTGTGGGCCACTACTACAACGATCGATTGCCCCTGGCATTGGCCCGGCGCTTC
AACCACGGTGCCTGGAAGCCCGAGTACCGCCTACAGGTGCTTTGGATTCCCAGTCTGATTCTCAACCCCATCGGA
CTGGGCCTGTTCGGCGCTACTCTGCAGTACCACCTGCATTACATGGTGCTCGCGTTGGCGGTGTTCATCGTGACG
ATTGGATCGCTGGCTAGTGTGCCGGTGACCGTCAACTACGTCGTGGAATGCTTCACGCGCTACCCGGCTGAAGCG
GGTATTGTGATCGGCGCCTACCGCATCGTCTACGGTTTGACCATCAGCTTCTACATTGACCCGTGGGTGGCGGCT
GTCGACGTCGGCTGGGTGTATGGCATGATGGCGTTCTTTGCTATCTTCTCGTTCCTGTTCGTCATGCTTCTGATG
TGGAAGGGACATGCCATCCGCGAATGGCAGCTGGCGAGTGTGGCCAGCAGTGAGGAAGGTGTGCAGGTCGAGGAT
GGGAGCAGTGAGAAGGGCGTGGTAGAACACGATGGAGAGAAGTTGAAGGTTTGA
Transcript >Ani_SJS100_1|g5906.t1
ATGACGCTCCTCCAGTCGCTCGAGGTGCCTCAGGAAGGAGAGACCATCCCCGACCGATGGATTAATAGTGACATT
GAACCCATCCAGGCGGATCGTCGCCGCTGGGGCTTTTGGACCTTTAACAACTACTGGGTCCTCATAAGCTCCAAC
ATCTCTGGCTACATGACCGGCAGCTCACTCATCGCCCTGGGACTGTCTTGGTGGCAGGCTATCGTCGCCATTGTG
ATCGGAAACATTCTGGCGACCATTTTTATCGTCCTCAACTCGCTGCCTGGGGCGTTTTATCATATTGGATTTCCT
GTGGTGAATCGATATGTCTGGGGCATGTATGGCAGCCAGTTTGTCATCTGGAACCGCATCTTTCTCTCTCTCATT
TGGTATGCCTTCCAGGCTTGGATTGGAGGCGAGTGTGTCTATGTCTGTCTGCAAGCCATTTGGCCCTCGCTGGAG
AAGCGCATCCCCAACCACATGCCCGCCGACACCGGTATGACGACCGCCGAATTTGTGGGGTACATCATCTTCATG
GTCCTCTCGCTTCCCGTCATCTATGTGCGACCGCATAAGCTGCAGAAAATGTTCTACATCTCTGCTGCCATTGTC
ATTGTTTTCGAATTCGTGCTCCTAATTTGGTCTCTGGCCACCATGGGTCCCGACGGCTTCGGTGACACACTAGCT
TCCGGGTCGCATGTCTCTGGGTGGATGATCGCGTATGGGATTATCAGCACGATCGGCAGCATCTGCGCCGGAATC
CTGAACCAGAACGATTACGCGCGGTTTGCACGACGACCCCGAGATGCCATCTATGGTCAAATCTTTAGTGCAGCA
CTGTACGCCATCATCTGCGGCATCATCGGCATTCTCGTCACGGCCGCCACGCAGGAGCGCTATGGAGAAGCCTAC
TGGAATCTTCCCAAGCTCCTGGGTGCAGTCATTGAGACTGGTGGTCCGCGATCGCGCGCGGCGGGCTTCTTCGGA
GGTATCGCGCTGATCATCTCGCAGATGGGGGTAAATGTGCCGGGCAACGCTTTGTCTGGAGGGTTCGATCTGGCG
GCGACCTTCCCCAGGTACATCAACATCCGTCGGGGCGCGTACCTGACGGCATTAGTCTCCATTGCAGCCAATCCC
TGGAGATTGGTCAACACGGCCACGGTCTTCATCACGGTCCTCAGTAGCTACTCGGTGTTCATGGCGCCGATGATC
GGGATGATGATCGCCTCGTACCTGTGCGTCCACCAGCGCAAGATCAAGGTCCCAGATCTCTTTGTAGGAGATGCA
CGGAGCATCTACTGGTATACATCCGGGGTGAATTGGCGGGCCATCGTCGCGTGGATTTGTGGGACAGTCCCCTCG
CTTCCCGGCTTCATAGCCTACGTCAACTCAACCATTCATGTTCCGGCCGGGCTGATGCATCTCTACTACATCTGC
TTCCTCAGCGGCGCGTTGATTGCCGGCGCCGTATTTGTGGCACTGCATTATGTCTTTCCCGACCGACGTGTGCGA
TCGTTCCTCGCGTCGGCGCCTACATCCCAGATGCTGATCGAGGAATACCGGGACCAGCAGATCTCAGTCGAAGCG
GTGATTTGTGAAAGGCCTCCGAAACTGTCGGACGATGAATTCAAGACACCCAGAACAATGACGGAGGAAGGTATC
AAAACCAGCAGTGAGGGCGAACGCCCTGGCCAGTCCCCGCCAGGGATCGTGCTGGTGCCTCGACCCAGTTCCCAT
CCTCAGGACCCGCTCAACTGGTCGCATCGTCGGAAACAAATCATCCTGGCCACTCTCTGCCTGGCCTCATTCTCG
GGGGCTATCGCTCCCCTATCGGGCCAGCTGAATCTGGCCCAGCAGGCCAAGATCTATGGCAAAACTCGCGTCCAA
GAGTCCTATGCTAACTCCGCTGCATTGGCGGGCATGGCCTTCGGGCCCTTTTTCTTCGCTCCCGTCGCCCACCGG
CTGGGTCGCAGCTCCGTTATTTTCTGGTGCATTCTCTGCGCCCTCATCTGTCAGATCTGGGGAGCCGTCATGACT
CATTCGGATGATTACATTCCCTACATCATCTCGCGACTATTTGCCGGCTTTTTCGGCGCCGTGCCCACCGTCCTG
GGCCCGCGTGTCATCACCGACCTGCTGTTCCTGCATCAGCGCGGTCGCGCCTTCATGGCCCTGCATATGGCCTTC
TTGTTTGGCACCATCGCCGGCCCGACCTTCTCGGCCTTCATCTCGGCCAATGCTTTCTTCCCCGTCGAGTTCTGG
TGGACCGTCGGCCTGTTGGGAGCCACGGCCATCCTCATCTTCCTCTTCCTCGAGGAGACGGGCTTTGACCGCGAG
AACCTTGACCGGAATCCTGCCATCCCGACTAACTGGCTGGCCAACCGCTGCGCTACCTTCTTTTTCGGCCAACGT
GTGGTGCAGCCCACCATCTGGTCGGTGACCATGAAAATTGCCGTGGCGCCCGTACTGATCGGAATCTGTCCGGTC
ACGGTCATCATGGGTACCTTCACTCTCATTTCCTTCGGCTTCTACGTCGGCATGAACGCTCTGGTGCCCGTGTGG
CTGCAGCGGACTCCAGAGGAGGGAGGTTACGGCTTCTCCCTGAAGCAAAATGCCGCCTTCACCTTCTGTCACTGG
ATCGGCATCCTCGTCGTCCAAATTGTGGGCCACTACTACAACGATCGATTGCCCCTGGCATTGGCCCGGCGCTTC
AACCACGGTGCCTGGAAGCCCGAGTACCGCCTACAGGTGCTTTGGATTCCCAGTCTGATTCTCAACCCCATCGGA
CTGGGCCTGTTCGGCGCTACTCTGCAGTACCACCTGCATTACATGGTGCTCGCGTTGGCGGTGTTCATCGTGACG
ATTGGATCGCTGGCTAGTGTGCCGGTGACCGTCAACTACGTCGTGGAATGCTTCACGCGCTACCCGGCTGAAGCG
GGTATTGTGATCGGCGCCTACCGCATCGTCTACGGTTTGACCATCAGCTTCTACATTGACCCGTGGGTGGCGGCT
GTCGACGTCGGCTGGGTGTATGGCATGATGGCGTTCTTTGCTATCTTCTCGTTCCTGTTCGTCATGCTTCTGATG
TGGAAGGGACATGCCATCCGCGAATGGCAGCTGGCGAGTGTGGCCAGCAGTGAGGAAGGTGTGCAGGTCGAGGAT
GGGAGCAGTGAGAAGGGCGTGGTAGAACACGATGGAGAGAAGTTGAAGGTTTGA
Gene >Ani_SJS100_1|g5906.t1
ATGACGCTCCTCCAGTCGCTCGAGGTGCCTCAGGAAGGAGAGACCATCCCCGACCGATGGATTAATAGTGACATT
GAACCCATCCAGGCGGATCGTCGCCGCTGGGGCTTTTGGACCTTTAACAACTACTGTTCGGGAGCATGGCCCTAT
GCTGCGTTGTGCAGGTCTCGCTAACAGGGGTATTGTTCGCAGGGGTCCTCATAAGCTCCAACATCTCTGGCTACA
TGACCGGCAGCTCACTCATCGCCCTGGGACTGTCTTGGTGGCAGGCTATCGTCGCCATTGTGATCGGAAACATTC
TGGCGACCATTTTTATCGTCCTCAACTCGCTGCCTGGGGCGTTTTATCATAGTAGGGATTTGGCAAACCTGTCGT
CGCGTGTTGGATTGACATGATGTTCAGTTGGATTTCCTGTGGTGAATCGATATGTCTGGGGCATGTATGGCAGCC
AGTTTGTCATCTGGAACCGCATCTTTCTCTCTCTCAGTAAGTCCCCATCGATGAAAGTCTGCAACTCTCCCACTG
ACAGATGCAGTTTGGTGTAAGTCACATCAGTACCAGTTCACGCGTGCCAACATGGATTGACCGCCAACTTCACGA
CAGATGCCTTCCAGGCTTGGATTGGAGGCGAGTGTGTCTATGTCTGTCTGCAAGCCATTTGGCCCTCGCTGGAGA
AGCGCATCCCCAACCACATGCCCGCCGACACCGGTATGACGACCGCCGAATTTGTGGGGTACATCATCTTCATGG
TCCTCTCGCTTCCCGTCATCTATGTGCGACCGCATAAGCTGCAGAAAATGTTCTACATCTCTGCTGCCATTGTCA
TTGTTTTCGAATTCGTGCTCCTAATTTGGTCTCTGGCCACCATGGGTCCCGACGGCTTCGGTGACACACTAGCTT
CCGGGTCGCATGTCTCTGGGTGGATGATCGCGTATGGGATTATCAGCACGATCGGCAGCATCTGCGCCGGAATCC
TGAACCAGAACGATTACGCGCGGTTTGCACGACGACCCCGAGATGCCATCTATGGTCAAATCTTTAGTGCAGCAC
TGTACGCCATCATCTGCGGCATCATCGGCATTCTCGTCACGGCCGCCACGCAGGAGCGCTATGGAGAAGCCTACT
GGAATCTTCCCAAGCTCCTGGGTGCAGTCATTGAGACTGGTGGTCCGCGATCGCGCGCGGCGGGCTTCTTCGGAG
GTATCGCGCTGATCATCTCGCAGATGGGGGTAAATGTGCCGGGCAACGCTTTGTCTGGAGGTGAGTATCTTATTT
GCACACAGCCCTTGTTGGGAAAATGATTGACGAAGCTAGGGTTCGATCTGGCGGCGACCTTCCCCAGGTACATCA
ACATCCGTCGGGGCGCGTACCTGACGGCATTAGTCTCCATTGCAGCCAATCCCTGGAGATTGGTCAACACGGCCA
CGGTCTTCATCACGGTCCTCAGTAGCTACTCGGTGTTCATGGCGCCGATGATCGGGATGATGATCGCCTCGTACC
TGTGCGTCCACCAGCGCAAGATCAAGGTCCCAGATCTCTTTGTAGGAGATGCACGGAGCATCTACTGGTATACAT
CCGGGGTGAATTGGCGGGCCATCGTCGCGGTCAGTCCCTCTGCAAGCTTCTTAGGTCCTACTTGACCTTCTCGGT
GGACTGACACTCTGGTAGTGGATTTGTGGGACAGTCCCCTCGCTTCCCGGCTTCATAGCCTACGTCAACTCAACC
ATTCATGTTCCGGCCGGGCTGATGCATCTCTACTACATCTGCTTCCTCAGCGGCGCGTTGATTGCCGGCGCCGTA
TTTGTGGCACTGCATTATGTCTTTCCCGACCGACGTGTGCGATCGTTCCTCGCGTCGGCGCCTACATCCCAGATG
CTGATCGAGGAATACCGGGACCAGCAGATCTCAGTCGAAGCGGTGATTTGTGAAAGGCCTCCGAAACTGTCGGAC
GATGAGTGAGCAGCCATCGTATAAAAGCGACTTTGATCATTGTGAGGTAGACATGCAGCGAGCCGTTATTACCCC
CGTTATCGTTCACATATTGGATGAGTGGACCTTAATAGATGGAGAGAATGATCGCAGTCTGTTAGATTAGAACTT
TGATACTGCGAGTGCCAGAGAGTATATGCATCTAGTTGCAACACTCTTGCAGGGAGTTCAATTCAGAGATGCTCC
CATTTTTCCTGCCAGGATGACTCGGATATATATATAACAGAGATGACAATACGCTGGTACTTAGTGACTCGTAGT
TGCGGCGGCATTGTAAGAGATACCACTAGTACTCAGTAGTGTATTGTCGTCCACAACAACTCTAACCAGGAGCAC
TGCCCTATTTACTTCATGAGGCCATAGCATTGAGTTCTTTGAATGTGGAAAGAAGGGTTGTGCTTGCCGGGGAAC
AAACCGAGTCCGATCCCCGTCTCCACTGCGGCTGGAAATATTTTCACCCCGATGCAGCAATGGTCCAACCCCCTG
AAGATGCAGGGTCTGGTCCAGACCCTCAGATGTGGGTTTCAGATGATAATATTCCGTATCAACAGCAGCTTGTAA
ATCGCCTAGCTATCTTAATAAAATTACCTTGTGTGCCAGTCGACCAATCCGGAACCGTAGCTTCACCGGAAATCC
TTACCGCGCTCGGTTTAACGCCGAGGATGACGCGTTCGGAAATCGATCGACAGGCGAAAATTGAAGCTGTCGAAA
ACCTCTTCAGGACCGCGGGGGAACACCCTGAACCTCTTTGAACCTGCTCCCGAGATCTCTGGATACTCCAGATTC
AAGACACCCAGAACAATGACGGAGGAAGGTATCAAAACCAGCAGTGAGGGCGAACGCCCTGGCCAGTCCCCGCCA
GGGATCGTGCTGGTGCCTCGACCCAGTTCCCATCCTCAGGACCCGCTCGTAAGCATCTGGCCCCCAGGACATCCT
TGGCCCCGGAGTTGAATTGCTGCTGATACATTGAAGAACTGGTCGCATCGTCGGAAACAAATCATCCTGGCCACT
CTCTGCCTGGCCTCATTCTCGGGGGCTATCGCTCCCCTATCGGGCCAGCTGAATCTGGCCCAGCAGGCCAAGATC
TATGGCAAAACTCGCGTCCAAGAGTCCTATGCTGTATGCTGACCAACTTGTATCACCATCCTGCTCCAGTATATG
TCCTGACAAGCTATGTAGAACTCCGCTGCATTGGCGGGCATGGCCTTCGGGCCCTTTTTCTTCGCTCCCGTCGCC
CACCGGCTGGGTCGCAGCTCCGTTATTTTCTGGTGCATTCTCTGCGCCCTCATCTGTCAGATCTGGGGAGCCGTC
ATGACTCATTCGGATGATTACATTCCCTACATCATCTCGCGACTATTTGCCGGCTTTTTCGGCGCCGTGCCCACC
GTCCTGGGCCCGCGTGTCATCACCGACCTGCTGTTCCTGCATCAGCGCGGTCGCGCCTTCATGGCCCTGCATATG
GCCTTCTTGTTTGGCACCATCGCCGGCCCGACCTTCTCGGCCTTCATCTCGGCCAATGCTTTCTTCCCCGTCGAG
TTCTGGTGGACCGTCGGCCTGTTGGGAGCCACGGCCATCCTCATCTTCCTCTTCCTCGAGGAGACGGGCTTTGAC
CGCGAGAACCTTGACCGGAATCCTGCCATCCCGACTAACTGGCTGGCCAACCGCTGCGCTACCTTCTTTTTCGGC
CAACGTGTGGTGCAGCCCACCATCTGGTCGGTGACCGTGAGTGGCCATCCGCCCCAATGTTTGCTATGGATTCTG
TTATGCTGACCCGTGTTCCAAGATGAAAATTGCCGTGGCGCCCGTACTGATCGGAATCTGTCCGGTCACGGTCAT
CATGGGTACCTTCACTCTCATTTCCTTCGGCTTCTACGTCGGCATGAACGCTCTGGTGCCCGTGTGGCTGCAGCG
GACTCCAGAGGAGGGAGGTTACGGCTTCTCCCTGAAGCAAAATGCCGCCTTCACCTTCTGTCACTGGATCGGCAT
CCTCGTCGTCCAAATTGTGGGCCACTACTACAACGATCGATTGCCCCTGGCATTGGCCCGGCGCTTCAACCACGG
TGCCTGGAAGCCCGAGTACCGCCTACAGGTGCTTTGGATTCCCAGTCTGATTCTCAACCCCATCGGACTGGGCCT
GTTCGGCGCTACTCTGCAGTACCACCTGCATTACATGGTGCTCGCGTTGGCGGTGTTCATCGTGACGATTGGATC
GCTGGCTAGTGTGCCGGTGACCGTCAACTACGTCGTGGAATGCTTCACGCGCTACCCGGCTGAAGCGGGTATTGT
GATCGGCGCCTACCGCATCGTCTACGGTTTGACCATCAGCTTCTACATTGACCCGTGGGTGGCGGCTGTCGACGT
CGGCTGGGTGTATGGCATGATGGCGTTCTTTGCTATCTTCTCGTTCCTGTTCGTCATGCTTCTGATGTGGAAGGG
ACATGCCATCCGCGAATGGCAGCTGGCGAGTGTGGCCAGCAGTGAGGAAGGTGTGCAGGTCGAGGATGGGAGCAG
TGAGAAGGGCGTGGTAGAACACGATGGAGAGAAGTTGAAGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail