Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5880.t1
Gene name
Locationscaffold_034:147280..148391
Strand-
Gene length (bp)1111
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 1.8E-19 80 323

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 150 168 18
2 293 310 17
3 323 345 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5880.t1
MQRKLELVDFTCFYEFCTYLLGAAGALLESDVVKTRPNNTRAYKEEWSWKDLVLTIWLFTADDFTTFVIPETAFG
ICAALSGPLLTDDNTPDLLSVVSRIPIVMLWNWLNLFVFNLANQRHPDSVAEDKINRPWRPLPAGRISILQTRRL
LLLAIPMVLASSVYLGAWEETALLYTLNWVYNDLSGGDDGFILRNVLLALAFSQYNKGSLRVATGTGFDILPRAW
RWIWVTSAVIGTTMHIQDIKDVEGDRAKNRRTMPIVMGDGPARWSVAVPVAIWSVVCPAFWELDVARYVLPVAVG
MTIAGRILLLREKAADKRTWKMWTAWTAVIWVLPLFKNASVFVRFGKKLGVV*
Coding >Ani_SJS100_1|g5880.t1
ATGCAGAGGAAACTGGAACTTGTTGATTTTACTTGCTTCTACGAGTTTTGCACTTATTTACTCGGCGCTGCAGGT
GCTTTGCTTGAAAGCGATGTCGTAAAGACAAGACCAAACAATACAAGGGCTTACAAAGAAGAATGGTCCTGGAAG
GACCTTGTCTTGACTATCTGGCTATTTACCGCGGATGACTTTACCACATTTGTCATACCTGAAACAGCATTCGGG
ATATGCGCCGCTCTTTCCGGGCCGCTTCTGACGGACGATAACACTCCGGACTTACTCTCAGTCGTTAGTCGGATA
CCCATTGTCATGCTCTGGAACTGGCTAAACCTGTTTGTGTTTAACCTGGCGAATCAAAGGCACCCGGACTCCGTG
GCAGAAGATAAGATCAACCGACCCTGGAGACCACTACCGGCAGGTCGGATCAGCATCCTGCAGACTCGCCGGTTG
CTTCTACTTGCAATTCCAATGGTGCTCGCATCCAGCGTGTATCTAGGTGCATGGGAGGAGACTGCTCTCCTTTAC
ACCCTTAACTGGGTATACAATGACCTCAGCGGTGGTGACGACGGGTTCATTCTACGGAATGTCCTTCTTGCCCTC
GCGTTCAGCCAATACAACAAGGGATCATTACGTGTTGCGACCGGAACTGGATTCGATATACTCCCTAGAGCATGG
CGGTGGATCTGGGTCACCAGTGCCGTGATCGGCACGACGATGCATATTCAAGATATCAAGGACGTGGAAGGAGAC
CGTGCCAAGAACCGCCGGACAATGCCCATTGTGATGGGTGACGGGCCGGCCCGGTGGTCCGTTGCAGTTCCTGTT
GCAATTTGGTCCGTTGTTTGTCCTGCGTTTTGGGAGCTAGACGTTGCCAGGTACGTTCTCCCGGTTGCGGTGGGA
ATGACTATTGCTGGGAGGATCTTGTTATTGCGGGAAAAGGCTGCTGATAAACGCACGTGGAAAATGTGGACGGCG
TGGACTGCAGTTATTTGGGTGCTTCCTTTGTTCAAGAATGCTAGTGTTTTTGTCAGGTTTGGTAAGAAGCTTGGG
GTGGTGTGA
Transcript >Ani_SJS100_1|g5880.t1
ATGCAGAGGAAACTGGAACTTGTTGATTTTACTTGCTTCTACGAGTTTTGCACTTATTTACTCGGCGCTGCAGGT
GCTTTGCTTGAAAGCGATGTCGTAAAGACAAGACCAAACAATACAAGGGCTTACAAAGAAGAATGGTCCTGGAAG
GACCTTGTCTTGACTATCTGGCTATTTACCGCGGATGACTTTACCACATTTGTCATACCTGAAACAGCATTCGGG
ATATGCGCCGCTCTTTCCGGGCCGCTTCTGACGGACGATAACACTCCGGACTTACTCTCAGTCGTTAGTCGGATA
CCCATTGTCATGCTCTGGAACTGGCTAAACCTGTTTGTGTTTAACCTGGCGAATCAAAGGCACCCGGACTCCGTG
GCAGAAGATAAGATCAACCGACCCTGGAGACCACTACCGGCAGGTCGGATCAGCATCCTGCAGACTCGCCGGTTG
CTTCTACTTGCAATTCCAATGGTGCTCGCATCCAGCGTGTATCTAGGTGCATGGGAGGAGACTGCTCTCCTTTAC
ACCCTTAACTGGGTATACAATGACCTCAGCGGTGGTGACGACGGGTTCATTCTACGGAATGTCCTTCTTGCCCTC
GCGTTCAGCCAATACAACAAGGGATCATTACGTGTTGCGACCGGAACTGGATTCGATATACTCCCTAGAGCATGG
CGGTGGATCTGGGTCACCAGTGCCGTGATCGGCACGACGATGCATATTCAAGATATCAAGGACGTGGAAGGAGAC
CGTGCCAAGAACCGCCGGACAATGCCCATTGTGATGGGTGACGGGCCGGCCCGGTGGTCCGTTGCAGTTCCTGTT
GCAATTTGGTCCGTTGTTTGTCCTGCGTTTTGGGAGCTAGACGTTGCCAGGTACGTTCTCCCGGTTGCGGTGGGA
ATGACTATTGCTGGGAGGATCTTGTTATTGCGGGAAAAGGCTGCTGATAAACGCACGTGGAAAATGTGGACGGCG
TGGACTGCAGTTATTTGGGTGCTTCCTTTGTTCAAGAATGCTAGTGTTTTTGTCAGGTTTGGTAAGAAGCTTGGG
GTGGTGTGA
Gene >Ani_SJS100_1|g5880.t1
ATGCAGAGGAAACTGGAACTTGTTGATTTTACTTGCTTCTACGAGTTTTGCACTTATTTACTCGGCGCTGCAGGT
GCTTTGCTTGAAAGCGATGTCGTAAAGACAAGACCAAACAATACAAGGGCTTACAAAGTGAGTGAACATTGCTAT
TACTCATGTTTCCAGAAGGCTCACAAGTGTATAGGAAGAATGGTCCTGGAAGGACCTTGTCTTGACTATCTGGCT
ATTTACCGCGGATGACTTTACCACATTTGTCATACCTGAAACAGCATTCGGGATATGCGCCGCTCTTTCCGGGCC
GCTTCTGACGGACGATAACACTCCGGACTTACTCTCAGTCGTTAGTCGGATACCCATTGTCATGCTCTGGAACTG
GCTAAACCTGTTTGTGTTTAACCTGGCGAATCAAAGGCACCCGGACTCCGTGGCAGAAGATAAGATCAACCGACC
CTGGAGACCACTACCGGCAGGTCGGATCAGCATCCTGCAGACTCGCCGGTTGCTTCTACTTGCAATTCCAATGGT
GCTCGCATCCAGCGTGTATCTAGGTGCATGGGAGGAGACTGCTCTCCTTTACACCCTTAACTGGGTATACAATGA
CCTCAGCGGTGGTGACGACGGGTTCATTCTACGGAATGTCCTTCTTGCCCTCGCGTTCAGCCAATACAACAAGGG
ATCATTACGTGTTGCGACCGGAACTGGATTCGATATACTCCCTAGAGCATGGCGGTGGATCTGGGTCACCAGTGC
CGTGATCGGCACGACGATGCATATTCAAGATATCAAGGACGTGGAAGGAGACCGTGCCAAGAACCGCCGGACAAT
GCCCATTGTGATGGGTGACGGGCCGGCCCGGTGGTCCGTTGCAGTTCCTGTTGCAATTTGGTCCGTTGTTTGTCC
TGCGTTTTGGGAGCTAGACGTTGCCAGGTACGTTCTCCCGGTTGCGGTGGGAATGACTATTGCTGGGAGGATCTT
GTTATTGCGGGAAAAGGCTGCTGATAAACGCACGTGGAAAATGTGGACGGCGTGGACTGCAGTTATTTGGGTGCT
TCCTTTGTTCAAGAATGCTAGTGTTTTTGTCAGGTTTGGTAAGAAGCTTGGGGTGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail