Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5867.t1
Gene name
Locationscaffold_034:117421..119838
Strand+
Gene length (bp)2417
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 1.2E-42 291 499
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 4.7E-19 17 210

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 340 362 22
2 369 391 22
3 406 428 22
4 460 477 17
5 481 503 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5867.t1
MAQEPTIHSQFEPNTGTWQYIVADPSTSKAVIIDPVLDYDSATQVISTSTADSLLVGIEEKNYSISYILETHAHA
DHLTAASYLASRISQKQGFRPSIGIGKHITQVQQLFGSRFQIPAEEYEGVFDKLWEDGETFKVGSLTATAMHLPG
HTPDHLGYKIGDNVFCGDSLFHADIGTARCDFPNGSAQSLYHSVQKLLSLPNHVRIWTGHDYPNANRTEPVPWLT
VRDHRTRNKHVNDDVTEEQFLALRQERDATLRQPKLLNPSLQTLTRQCTGYLTEQIREDLTLESQLLLLSFAIGI
QDAAAWKDYGCFASNQTGNMLFLAIGGAGLASNDDFDFTYVGMSLGSFVAGGLVMGQFANYLGVVRMRWWLLFSS
LLQTVMVFAAAAIMAYTNPVKQQTTNDPPALVTLFLLAFSSGAQVSMGRALKVTDITTAMATAAYIDVVIDPGLF
RARNRMRNRRVLFLVMLTAGCFAGAGVEKSAGSCATLIMCGCLKVLVTVLFFFTPRMKVGV*
Coding >Ani_SJS100_1|g5867.t1
ATGGCTCAAGAACCCACGATTCATTCCCAGTTCGAACCCAACACGGGCACCTGGCAATACATAGTAGCCGACCCA
TCAACATCAAAAGCCGTCATCATCGACCCAGTACTCGACTACGACTCCGCTACTCAGGTTATAAGCACGTCCACT
GCTGACAGCTTACTTGTTGGAATCGAAGAAAAGAACTACAGCATCTCCTATATTCTTGAAACACATGCGCACGCC
GACCACTTGACTGCAGCATCGTACCTGGCATCCCGCATCAGCCAGAAACAAGGATTCCGACCGTCCATCGGTATC
GGAAAGCACATCACACAAGTGCAACAACTCTTTGGCAGCCGGTTTCAAATTCCCGCTGAGGAGTACGAAGGAGTC
TTCGACAAGCTCTGGGAAGATGGCGAGACATTTAAAGTCGGGTCGTTGACAGCTACGGCCATGCATCTACCCGGC
CATACTCCTGATCATTTGGGATACAAGATTGGAGATAATGTCTTCTGCGGCGACTCTCTCTTCCATGCCGACATT
GGTACTGCCCGCTGCGACTTTCCCAACGGCAGCGCTCAAAGCCTCTACCACTCCGTCCAGAAACTCCTTAGCCTG
CCAAATCACGTCAGAATCTGGACAGGCCATGATTACCCCAACGCAAACCGGACTGAGCCTGTGCCGTGGCTGACT
GTCCGCGACCATCGAACGCGCAACAAGCATGTCAACGATGATGTTACCGAGGAGCAGTTCTTGGCTTTGCGGCAG
GAGCGTGATGCTACCCTCCGTCAGCCAAAGTTGTTGAATCCGTCATTGCAGACCCTCACACGCCAATGCACCGGA
TATCTAACCGAACAAATCCGCGAAGACCTAACTCTCGAATCGCAACTCCTCCTCCTCTCCTTCGCCATTGGCATC
CAAGATGCCGCCGCGTGGAAAGACTACGGCTGCTTCGCCTCCAACCAAACAGGCAACATGCTCTTCCTGGCTATC
GGCGGTGCCGGACTTGCCAGCAACGACGATTTTGATTTCACCTACGTGGGGATGAGTCTGGGGTCTTTTGTGGCC
GGTGGGCTGGTAATGGGCCAATTCGCTAATTATCTGGGCGTGGTACGCATGCGCTGGTGGTTACTTTTCTCGAGT
CTGTTGCAGACGGTGATGGTATTTGCCGCAGCGGCGATTATGGCGTATACAAACCCGGTGAAGCAGCAGACTACT
AATGATCCACCGGCGCTGGTGACGTTGTTTTTATTGGCGTTTTCATCCGGTGCACAGGTTTCTATGGGGAGAGCG
TTGAAGGTTACGGATATTACGACGGCTATGGCGACGGCGGCGTATATTGATGTGGTTATTGATCCTGGTTTGTTT
CGGGCAAGGAATCGGATGCGGAATCGTAGGGTTTTATTTTTGGTTATGTTGACGGCGGGGTGTTTTGCTGGTGCG
GGCGTGGAGAAGTCGGCTGGGTCGTGTGCTACGTTGATTATGTGTGGGTGTTTGAAGGTTCTGGTTACTGTGTTA
TTCTTTTTTACGCCAAGAATGAAGGTGGGGGTCTGA
Transcript >Ani_SJS100_1|g5867.t1
ATGGCTCAAGAACCCACGATTCATTCCCAGTTCGAACCCAACACGGGCACCTGGCAATACATAGTAGCCGACCCA
TCAACATCAAAAGCCGTCATCATCGACCCAGTACTCGACTACGACTCCGCTACTCAGGTTATAAGCACGTCCACT
GCTGACAGCTTACTTGTTGGAATCGAAGAAAAGAACTACAGCATCTCCTATATTCTTGAAACACATGCGCACGCC
GACCACTTGACTGCAGCATCGTACCTGGCATCCCGCATCAGCCAGAAACAAGGATTCCGACCGTCCATCGGTATC
GGAAAGCACATCACACAAGTGCAACAACTCTTTGGCAGCCGGTTTCAAATTCCCGCTGAGGAGTACGAAGGAGTC
TTCGACAAGCTCTGGGAAGATGGCGAGACATTTAAAGTCGGGTCGTTGACAGCTACGGCCATGCATCTACCCGGC
CATACTCCTGATCATTTGGGATACAAGATTGGAGATAATGTCTTCTGCGGCGACTCTCTCTTCCATGCCGACATT
GGTACTGCCCGCTGCGACTTTCCCAACGGCAGCGCTCAAAGCCTCTACCACTCCGTCCAGAAACTCCTTAGCCTG
CCAAATCACGTCAGAATCTGGACAGGCCATGATTACCCCAACGCAAACCGGACTGAGCCTGTGCCGTGGCTGACT
GTCCGCGACCATCGAACGCGCAACAAGCATGTCAACGATGATGTTACCGAGGAGCAGTTCTTGGCTTTGCGGCAG
GAGCGTGATGCTACCCTCCGTCAGCCAAAGTTGTTGAATCCGTCATTGCAGACCCTCACACGCCAATGCACCGGA
TATCTAACCGAACAAATCCGCGAAGACCTAACTCTCGAATCGCAACTCCTCCTCCTCTCCTTCGCCATTGGCATC
CAAGATGCCGCCGCGTGGAAAGACTACGGCTGCTTCGCCTCCAACCAAACAGGCAACATGCTCTTCCTGGCTATC
GGCGGTGCCGGACTTGCCAGCAACGACGATTTTGATTTCACCTACGTGGGGATGAGTCTGGGGTCTTTTGTGGCC
GGTGGGCTGGTAATGGGCCAATTCGCTAATTATCTGGGCGTGGTACGCATGCGCTGGTGGTTACTTTTCTCGAGT
CTGTTGCAGACGGTGATGGTATTTGCCGCAGCGGCGATTATGGCGTATACAAACCCGGTGAAGCAGCAGACTACT
AATGATCCACCGGCGCTGGTGACGTTGTTTTTATTGGCGTTTTCATCCGGTGCACAGGTTTCTATGGGGAGAGCG
TTGAAGGTTACGGATATTACGACGGCTATGGCGACGGCGGCGTATATTGATGTGGTTATTGATCCTGGTTTGTTT
CGGGCAAGGAATCGGATGCGGAATCGTAGGGTTTTATTTTTGGTTATGTTGACGGCGGGGTGTTTTGCTGGTGCG
GGCGTGGAGAAGTCGGCTGGGTCGTGTGCTACGTTGATTATGTGTGGGTGTTTGAAGGTTCTGGTTACTGTGTTA
TTCTTTTTTACGCCAAGAATGAAGGTGGGGGTCTGA
Gene >Ani_SJS100_1|g5867.t1
ATGGCTCAAGAACCCACGATTCATTCCCAGTTCGAACCCAACACGGGCACCTGGCAATACATAGTAGCCGACCCA
TCAACATCAAAAGCCGTCATCATCGACCCAGTACTCGACTACGACTCCGCTACTCAGGTTATAAGCACGTCCACT
GCTGACAGCTTACTTGTTGGAATCGAAGAAAAGAACTACAGCATCTCCTATATTCTTGAAACACATGCGCACGCC
GACCACTTGACTGCAGCATCGTACCTGGCATCCCGCATCAGCCAGAAACAAGGATTCCGACCGTCCATCGGTATC
GGAAAGCACATCACACAAGTGCAACAACTCTTTGGCAGCCGGTTTCAAATTCCCGCTGAGGAGTACGAAGGAGTC
TTCGACAAGCTCTGGGAAGATGGCGAGACATTTAAAGTCGGGTCGTTGACAGCTACGGCCATGCATCTACCCGGC
CATACTCCTGATCATTTGGGATACAAGATTGGAGGTTCGTCCTTCCGCTATCATGGCTCTCTTTAGATAAGTATA
GGCGAAATCATGCTAACATTTGGTGCACAGATAATGTCTTCTGCGGCGACTCTCTCTTCCATGCCGACATTGGTA
CTGCCCGCTGCGACTTTCCCAACGGCAGCGCTCAAAGCCTCTACCACTCCGTCCAGAAACTCCTTAGCCTGCCAA
ATCACGTCAGAATCTGGACAGGCCATGATTACCCCAACGCAAACCGGACTGAGCCTGTGCCGTGGCTGACTGTCC
GCGACCATCGAACGCGCAACAAGCATGTCAACGATGATGTTACCGAGGAGCAGTTCTTGGCTTTGCGGCAGGAGC
GTGATGCTACCCTCCGTCAGCCAAAGTTGTTGAATCCGTCATTGCAGGTGAATATCCGTGCTGGAAGGCTGCCGA
GAAAGACGGAGTCTGGAATGCGAATGTTACATTTGCCGTTGAAGGTAGATGGAGAGGAATGGTGATGAAGATGGG
GAGATCTTTGTTCATCATTATTATTCTACCTTAATAGTGTGCCATCTTTCTTAAATTGTTCGAATAATACATTCT
AAATGAATATTTATTGTAATCAAGCACGTTCAAGCCATAAATGACAGTACAATACTCATGCTACTTACCTATGCT
GTAATTCATGTGTTCAATCCACTGATTCGGGTGGAAAGTTGTCGCCGTCCTCCCACTCAGGAATTCAGTAAATGT
AAGGTTTACAGTTAAGAATATCCTCTAACTCAGAATAATTCTTCGCATCTCCCAGAACTTAGAATGGGGTTGGTG
GCCGACGACCCCTTTTGCTACCTGTATGGGTCATAGACGCCGAATGCCCGAACTTTATCCGAGACGGCGAATGCC
AATCGCCGATCTCAAAACTGTTTTATGCATCATGACAAAATTCGGTATTCACTATCGGCCGATTGTAGAATTCTG
CTTCTAGAACATATTAGAGTTAGTGTTCCTGGCATACCGTGAACTCACTCCCAATCCCACAGCTAGTGCCCATAG
ACCTACCCCATGTCTCCCAGTCAATGAACAACTATCTATCCGCCTCACATCCAACAACCACAATGTTAATACCGA
ACACCAAATCACGTACACAACTTCCGACATCAAACACCTCACACCCACCCTCACAACCATACAAAAACAACCTCC
CCCTCCCCGCCGTCCACAGCTCACCCACCCAGACCCTCACACGCCAATGCACCGGATATCTAACCGAACAAATCC
GCGAAGACCTAACTCTCGAATCGCAACTCCTCCTCCTCTCCTTCGCCATTGGCATCCAAGATGCCGCCGCGTGGA
AAGACTACGGCTGCTTCGCCTCCAACCAAACAGGCAACATGCTCTTCCTGGCTATCGGCGGTGCCGGACTTGCCA
GCAACGACGATTTTGATTTCACCTACGTGGGGATGAGTCTGGGGTCTTTTGTGGCCGGTGGGCTGGTAATGGGCC
AATTCGCTAATTATCTGGGCGTGGTACGCATGCGCTGGTGGTTACTTTTCTCGAGTCTGTTGCAGACGGTGATGG
TATTTGCCGCAGCGGCGATTATGGCGTATACAAACCCGGTGAAGCAGCAGACTACTAATGATCCACCGGCGCTGG
TGACGTTGTTTTTATTGGCGTTTTCATCCGGTGCACAGGTTTCTATGGGGAGAGCGTTGAAGGTTACGGATATTA
CGACGGCTATGGCGACGGCGGCGTATATTGATGTGGTTATTGATCCTGGTTTGTTTCGGGCAAGGAATCGGATGC
GGAATCGTAGGGTTTTATTTTTGGTTATGTTGACGGCGGGGTGTTTTGCTGGTGCGGGCGTGGAGAAGTCGGCTG
GGTCGTGTGCTACGTTGATTATGTGTGGGTGTTTGAAGGTTCTGGTTACTGTGTTATTCTTTTTTACGCCAAGAA
TGAAGGTGGGGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail