Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5784.t1
Gene name
Locationscaffold_033:238040..238760
Strand-
Gene length (bp)720
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03306 AAL_decarboxy Alpha-acetolactate decarboxylase 3.1E-75 5 222

GO

GO Term Description Terminal node
GO:0047605 acetolactate decarboxylase activity Yes
GO:0045151 acetoin biosynthetic process Yes
GO:0046165 alcohol biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016829 lyase activity No
GO:1901615 organic hydroxy compound metabolic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0016831 carboxy-lyase activity No
GO:0008152 metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1902653 secondary alcohol biosynthetic process No
GO:1902652 secondary alcohol metabolic process No
GO:0009058 biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0042181 ketone biosynthetic process No
GO:0008150 biological_process No
GO:0044283 small molecule biosynthetic process No
GO:0045149 acetoin metabolic process No
GO:0003824 catalytic activity No
GO:0006066 alcohol metabolic process No
GO:0042180 cellular ketone metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5784.t1
MANCIYQYSVLGALMDGICQDGTTAQNILKHGDHGIGTMRGLNGELVIIDGVAYHFPADGPLRPVEDADIIPYAM
ATKFQPTLTSHVPCTSMSSLFDTLSPVFPGEQNVFLSIRLVASFSRVVFRVIPAQSNPRETLLDLAKRQEIRECR
HIQGTLFGFWSPKYTSGLSVPGFHLHLLSTDRTLGGHVMDFDAEDGQLGAAVVRNYQVELPDSEEFREAPLNCVK
EQELHTAEGVPTSH*
Coding >Ani_SJS100_1|g5784.t1
ATGGCAAACTGCATATACCAATACTCCGTGCTGGGAGCGCTCATGGACGGCATCTGTCAAGATGGAACCACGGCG
CAAAACATTCTCAAACATGGTGACCATGGCATCGGCACCATGCGCGGTCTCAACGGCGAACTAGTGATCATCGAC
GGGGTGGCATATCACTTCCCAGCGGACGGACCCCTACGCCCTGTCGAAGACGCGGATATAATTCCATACGCAATG
GCTACTAAGTTCCAGCCCACGCTGACCAGCCATGTTCCCTGCACCTCCATGTCGTCTCTATTCGACACGCTGTCA
CCTGTATTTCCGGGTGAGCAGAACGTCTTCCTCTCGATTCGACTCGTTGCCTCCTTCTCGCGGGTCGTCTTTCGC
GTGATTCCAGCCCAGTCAAACCCACGGGAAACCCTTTTAGATCTGGCGAAAAGGCAGGAGATCCGAGAATGCAGA
CATATACAGGGCACGCTGTTCGGATTTTGGTCACCCAAGTATACCAGTGGGCTTAGCGTACCGGGATTCCACCTG
CATTTGCTGTCCACGGATCGTACTTTGGGCGGCCATGTTATGGATTTTGATGCAGAGGATGGGCAGCTGGGTGCA
GCAGTGGTGAGAAATTATCAGGTGGAACTTCCTGATTCGGAGGAATTTCGCGAGGCACCCTTGAACTGCGTGAAG
GAGCAAGAGCTGCACACTGCTGAGGGAGTCCCCACTTCTCACTAA
Transcript >Ani_SJS100_1|g5784.t1
ATGGCAAACTGCATATACCAATACTCCGTGCTGGGAGCGCTCATGGACGGCATCTGTCAAGATGGAACCACGGCG
CAAAACATTCTCAAACATGGTGACCATGGCATCGGCACCATGCGCGGTCTCAACGGCGAACTAGTGATCATCGAC
GGGGTGGCATATCACTTCCCAGCGGACGGACCCCTACGCCCTGTCGAAGACGCGGATATAATTCCATACGCAATG
GCTACTAAGTTCCAGCCCACGCTGACCAGCCATGTTCCCTGCACCTCCATGTCGTCTCTATTCGACACGCTGTCA
CCTGTATTTCCGGGTGAGCAGAACGTCTTCCTCTCGATTCGACTCGTTGCCTCCTTCTCGCGGGTCGTCTTTCGC
GTGATTCCAGCCCAGTCAAACCCACGGGAAACCCTTTTAGATCTGGCGAAAAGGCAGGAGATCCGAGAATGCAGA
CATATACAGGGCACGCTGTTCGGATTTTGGTCACCCAAGTATACCAGTGGGCTTAGCGTACCGGGATTCCACCTG
CATTTGCTGTCCACGGATCGTACTTTGGGCGGCCATGTTATGGATTTTGATGCAGAGGATGGGCAGCTGGGTGCA
GCAGTGGTGAGAAATTATCAGGTGGAACTTCCTGATTCGGAGGAATTTCGCGAGGCACCCTTGAACTGCGTGAAG
GAGCAAGAGCTGCACACTGCTGAGGGAGTCCCCACTTCTCACTAA
Gene >Ani_SJS100_1|g5784.t1
ATGGCAAACTGCATATACCAATACTCCGTGCTGGGAGCGCTCATGGACGGCATCTGTCAAGATGGAACCACGGCG
CAAAACATTCTCAAACATGGTGACCATGGCATCGGCACCATGCGCGGTCTCAACGGCGAACTAGTGATCATCGAC
GGGGTGGCATATCACTTCCCAGCGGACGGACCCCTACGCCCTGTCGAAGACGCGGATATAATTCCATACGCAATG
GCTACTAAGTTCCAGCCCACGCTGACCAGCCATGTTCCCTGCACCTCCATGTCGTCTCTATTCGACACGCTGTCA
CCTGTATTTCCGGGTGAGCAGAACGTCTTCCTCTCGATTCGACTCGTTGCCTCCTTCTCGCGGGTCGTCTTTCGC
GTGATTCCAGCCCAGTCAAACCCACGGGAAACCCTTTTAGATCTGGCGAAAAGGCAGGAGATCCGAGAATGCAGA
CATATACAGGGCACGCTGTTCGGATTTTGGTCACCCAAGTATACCAGTGGGCTTAGCGTACCGGGATTCCACCTG
CATTTGCTGTCCACGGATCGTACTTTGGGCGGCCATGTTATGGATTTTGATGCAGAGGATGGGCAGCTGGGTGCA
GCAGTGGTGAGAAATTATCAGGTGGAACTTCCTGATTCGGAGGAATTTCGCGAGGCACCCTTGAACTGCGTGAAG
GAGCAAGAGCTGCACACTGCTGAGGGAGTCCCCACTTCTCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail