Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5774.t1
Gene name
Locationscaffold_033:200641..201796
Strand+
Gene length (bp)1155
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain 2.2E-35 183 330
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.5E-04 5 107

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5774.t1
MDRPRVGIIGVGHAGCALAVDFESRNVKAILWAAPGHRRVYDRLAEQGHLDATEAITGRFYPSLTQELADVLQAT
RVILIAVPSTAHDEIIATLAQYNLSQHVVIFITGNFIASIAAARLQAKAVMTTSRAPYSSRTQLNDAGEVQIRIN
GIKKRLEIARFGGPVDQRTRHYLGLLFSMPLVWYTNTLQLDLSTNHGVVHPPTMLCNIGPIRRQETGLFFYRDCM
TPEVCDLMLAADRERLQVAAALGFTEMESVLDMFNADYGAQCSDLASFVASNAQLNKRPGLPGSMLARQVSQDIP
FWCVPVASLGEALGVPTPIISGWILSCSTLNKTDYRAVGRTLSSFSLPEGASKEEILLAFNALDDEEKGIGSLQS
QGFALTASL*
Coding >Ani_SJS100_1|g5774.t1
ATGGACAGACCAAGAGTTGGAATCATTGGCGTCGGCCACGCTGGCTGCGCGCTCGCCGTCGATTTCGAAAGTCGA
AACGTAAAAGCCATCCTGTGGGCAGCGCCTGGGCATCGCCGAGTCTACGACCGTCTGGCCGAACAAGGCCATCTA
GATGCCACTGAGGCTATCACCGGCCGGTTCTACCCTAGCCTCACGCAAGAGCTGGCCGACGTCCTGCAAGCGACC
AGAGTAATCCTGATTGCGGTGCCGTCTACTGCGCATGATGAGATTATAGCCACATTGGCGCAATACAATCTTAGC
CAGCATGTCGTCATCTTCATCACGGGTAACTTCATCGCGTCCATTGCGGCGGCTCGACTCCAAGCCAAGGCAGTG
ATGACCACCTCGCGGGCCCCATACTCATCCCGCACGCAGCTGAACGACGCCGGCGAAGTGCAAATCCGAATCAAT
GGCATCAAGAAGAGGTTGGAAATTGCGCGTTTCGGGGGACCAGTGGATCAGCGGACCCGCCATTACCTCGGACTT
TTGTTTTCCATGCCCCTGGTCTGGTATACCAACACGCTGCAACTGGACCTGTCCACGAACCACGGCGTGGTCCAC
CCGCCAACTATGTTGTGCAACATCGGGCCCATTCGCCGGCAGGAGACGGGGCTGTTCTTCTACCGCGATTGCATG
ACGCCCGAGGTATGCGACCTCATGCTCGCCGCCGACAGGGAGCGGCTGCAGGTGGCGGCTGCCCTCGGCTTCACT
GAAATGGAAAGTGTGCTGGACATGTTCAACGCCGACTACGGTGCTCAATGTTCCGACCTGGCCAGCTTTGTCGCC
AGCAACGCGCAGCTCAACAAACGACCTGGACTGCCTGGTAGCATGCTTGCGCGTCAGGTCTCCCAGGATATTCCG
TTCTGGTGCGTGCCGGTCGCCAGCTTGGGCGAGGCATTGGGAGTTCCCACGCCTATCATAAGCGGATGGATCTTG
TCTTGCAGCACGCTGAATAAGACAGATTATCGTGCCGTGGGGCGGACGCTGTCATCTTTTAGTCTGCCGGAGGGG
GCATCCAAGGAGGAGATTCTTTTAGCCTTTAATGCCTTGGATGATGAAGAGAAAGGCATCGGGAGCCTACAGAGT
CAGGGGTTTGCGCTTACTGCGTCGCTATGA
Transcript >Ani_SJS100_1|g5774.t1
ATGGACAGACCAAGAGTTGGAATCATTGGCGTCGGCCACGCTGGCTGCGCGCTCGCCGTCGATTTCGAAAGTCGA
AACGTAAAAGCCATCCTGTGGGCAGCGCCTGGGCATCGCCGAGTCTACGACCGTCTGGCCGAACAAGGCCATCTA
GATGCCACTGAGGCTATCACCGGCCGGTTCTACCCTAGCCTCACGCAAGAGCTGGCCGACGTCCTGCAAGCGACC
AGAGTAATCCTGATTGCGGTGCCGTCTACTGCGCATGATGAGATTATAGCCACATTGGCGCAATACAATCTTAGC
CAGCATGTCGTCATCTTCATCACGGGTAACTTCATCGCGTCCATTGCGGCGGCTCGACTCCAAGCCAAGGCAGTG
ATGACCACCTCGCGGGCCCCATACTCATCCCGCACGCAGCTGAACGACGCCGGCGAAGTGCAAATCCGAATCAAT
GGCATCAAGAAGAGGTTGGAAATTGCGCGTTTCGGGGGACCAGTGGATCAGCGGACCCGCCATTACCTCGGACTT
TTGTTTTCCATGCCCCTGGTCTGGTATACCAACACGCTGCAACTGGACCTGTCCACGAACCACGGCGTGGTCCAC
CCGCCAACTATGTTGTGCAACATCGGGCCCATTCGCCGGCAGGAGACGGGGCTGTTCTTCTACCGCGATTGCATG
ACGCCCGAGGTATGCGACCTCATGCTCGCCGCCGACAGGGAGCGGCTGCAGGTGGCGGCTGCCCTCGGCTTCACT
GAAATGGAAAGTGTGCTGGACATGTTCAACGCCGACTACGGTGCTCAATGTTCCGACCTGGCCAGCTTTGTCGCC
AGCAACGCGCAGCTCAACAAACGACCTGGACTGCCTGGTAGCATGCTTGCGCGTCAGGTCTCCCAGGATATTCCG
TTCTGGTGCGTGCCGGTCGCCAGCTTGGGCGAGGCATTGGGAGTTCCCACGCCTATCATAAGCGGATGGATCTTG
TCTTGCAGCACGCTGAATAAGACAGATTATCGTGCCGTGGGGCGGACGCTGTCATCTTTTAGTCTGCCGGAGGGG
GCATCCAAGGAGGAGATTCTTTTAGCCTTTAATGCCTTGGATGATGAAGAGAAAGGCATCGGGAGCCTACAGAGT
CAGGGGTTTGCGCTTACTGCGTCGCTATGA
Gene >Ani_SJS100_1|g5774.t1
ATGGACAGACCAAGAGTTGGAATCATTGGCGTCGGCCACGCTGGCTGCGCGCTCGCCGTCGATTTCGAAAGTCGA
AACGTAAAAGCCATCCTGTGGGCAGCGCCTGGGCATCGCCGAGTCTACGACCGTCTGGCCGAACAAGGCCATCTA
GATGCCACTGAGGCTATCACCGGCCGGTTCTACCCTAGCCTCACGCAAGAGCTGGCCGACGTCCTGCAAGCGACC
AGAGTAATCCTGATTGCGGTGCCGTCTACTGCGCATGATGAGATTATAGCCACATTGGCGCAATACAATCTTAGC
CAGCATGTCGTCATCTTCATCACGGGTAACTTCATCGCGTCCATTGCGGCGGCTCGACTCCAAGCCAAGGCAGTG
ATGACCACCTCGCGGGCCCCATACTCATCCCGCACGCAGCTGAACGACGCCGGCGAAGTGCAAATCCGAATCAAT
GGCATCAAGAAGAGGTTGGAAATTGCGCGTTTCGGGGGACCAGTGGATCAGCGGACCCGCCATTACCTCGGACTT
TTGTTTTCCATGCCCCTGGTCTGGTATACCAACACGCTGCAACTGGACCTGTCCACGAACCACGGCGTGGTCCAC
CCGCCAACTATGTTGTGCAACATCGGGCCCATTCGCCGGCAGGAGACGGGGCTGTTCTTCTACCGCGATTGCATG
ACGCCCGAGGTATGCGACCTCATGCTCGCCGCCGACAGGGAGCGGCTGCAGGTGGCGGCTGCCCTCGGCTTCACT
GAAATGGAAAGTGTGCTGGACATGTTCAACGCCGACTACGGTGCTCAATGTTCCGACCTGGCCAGCTTTGTCGCC
AGCAACGCGCAGCTCAACAAACGACCTGGACTGCCTGGTAGCATGCTTGCGCGTCAGGTCTCCCAGGATATTCCG
TTCTGGTGCGTGCCGGTCGCCAGCTTGGGCGAGGCATTGGGAGTTCCCACGCCTATCATAAGCGGATGGATCTTG
TCTTGCAGCACGCTGAATAAGACAGATTATCGTGCCGTGGGGCGGACGCTGTCATCTTTTAGTCTGCCGGAGGGG
GCATCCAAGGAGGAGATTCTTTTAGCCTTTAATGCCTTGGATGATGAAGAGAAAGGCATCGGGAGCCTACAGAGT
CAGGGGTTTGCGCTTACTGCGTCGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail