Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5754.t1
Gene name
Locationscaffold_033:143207..144820
Strand-
Gene length (bp)1613
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 7.2E-06 27 74

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 100 122 22
3 135 157 22
4 177 198 21
5 205 227 22
6 257 279 22
7 292 314 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5754.t1
MKIHQCLITILAALTVSVFAASSNGTEFPECAVSCLHQESPNCTITDASCVCTGDASKSSLVTCALSNCSALDYY
ITRHMYELECDQPIKKGPPLVDPSTLAPAILATIFFFIRIAAKLANLAGGWGLDDLTVTIAWILGVALFVVNTYM
IKYGFGMNTWDILPFHHVTLVFQYFEGLAMMYKIQISLCKISVLLFLLRIFQSRVFRVCAYILIAINAAIGITFS
LVDLLRCVPVHLDWHSWTGEYEGVGTCINFIAAVLVHCLVNIFVDVVIVLLPIYEVSKLQLPWMKKINVALMFMM
GLILTIIAIIRVIVFWENRWTTNLTAGLQPLIHWSVIESQIAIMTTCLPAARAFINQYVPGLPGSTQRRTYGRTN
SLYNNGGASSGVTNSKISKSVNISVDYTTRSERDSTSAVHLVDMDGRYERF*
Coding >Ani_SJS100_1|g5754.t1
ATGAAGATACATCAGTGTTTAATCACCATATTGGCAGCGTTGACGGTATCTGTGTTCGCCGCGTCGTCAAATGGC
ACAGAATTCCCAGAGTGTGCGGTGTCTTGTTTGCACCAAGAATCTCCAAATTGCACCATCACCGACGCATCATGT
GTATGTACCGGCGATGCGAGCAAGTCGTCGCTAGTGACTTGCGCACTATCGAACTGCAGTGCACTGGATTACTAT
ATCACGCGGCATATGTATGAACTGGAATGCGATCAGCCCATTAAGAAGGGGCCCCCTCTTGTCGATCCTTCGACT
CTTGCACCAGCTATCCTCGCCACGATATTCTTCTTTATCCGGATAGCTGCTAAACTCGCAAACCTCGCTGGTGGT
TGGGGACTTGACGACCTCACTGTCACGATCGCATGGATACTGGGAGTTGCCTTGTTTGTTGTGAATACATACATG
ATCAAATACGGTTTCGGCATGAATACCTGGGATATCTTACCCTTCCACCACGTCACATTAGTCTTCCAGTACTTC
GAAGGTCTGGCGATGATGTACAAGATCCAAATCTCGCTCTGCAAGATATCCGTCCTACTCTTCCTGCTGCGAATC
TTCCAGTCCCGTGTTTTCCGCGTATGCGCATATATACTCATCGCCATCAACGCCGCCATCGGCATCACGTTTTCC
CTCGTGGATCTGCTTCGCTGCGTGCCAGTCCACCTGGACTGGCATTCCTGGACCGGCGAATACGAGGGCGTGGGA
ACATGCATCAATTTCATCGCAGCAGTTTTAGTCCACTGTCTTGTCAACATTTTCGTCGACGTCGTCATCGTCCTC
CTACCGATCTACGAAGTCAGCAAGTTGCAGCTGCCATGGATGAAGAAGATCAACGTGGCACTGATGTTCATGATG
GGTCTTATTTTAACTATTATCGCTATCATTCGTGTGATCGTATTCTGGGAGAACCGCTGGACCACCAACTTGACC
GCCGGTCTCCAGCCCCTCATTCACTGGTCCGTCATCGAATCCCAGATCGCAATCATGACGACCTGTCTCCCCGCC
GCCCGCGCGTTCATAAACCAATACGTCCCAGGTCTTCCCGGCAGCACACAACGACGGACCTACGGCCGAACCAAC
TCTCTGTACAACAACGGAGGTGCATCCTCAGGGGTCACCAACAGCAAGATTTCCAAGTCAGTGAATATCTCCGTT
GACTATACGACACGGTCGGAGAGGGATTCGACCAGCGCTGTGCATTTGGTGGACATGGACGGGAGGTATGAACGG
TTTTAA
Transcript >Ani_SJS100_1|g5754.t1
ATGAAGATACATCAGTGTTTAATCACCATATTGGCAGCGTTGACGGTATCTGTGTTCGCCGCGTCGTCAAATGGC
ACAGAATTCCCAGAGTGTGCGGTGTCTTGTTTGCACCAAGAATCTCCAAATTGCACCATCACCGACGCATCATGT
GTATGTACCGGCGATGCGAGCAAGTCGTCGCTAGTGACTTGCGCACTATCGAACTGCAGTGCACTGGATTACTAT
ATCACGCGGCATATGTATGAACTGGAATGCGATCAGCCCATTAAGAAGGGGCCCCCTCTTGTCGATCCTTCGACT
CTTGCACCAGCTATCCTCGCCACGATATTCTTCTTTATCCGGATAGCTGCTAAACTCGCAAACCTCGCTGGTGGT
TGGGGACTTGACGACCTCACTGTCACGATCGCATGGATACTGGGAGTTGCCTTGTTTGTTGTGAATACATACATG
ATCAAATACGGTTTCGGCATGAATACCTGGGATATCTTACCCTTCCACCACGTCACATTAGTCTTCCAGTACTTC
GAAGGTCTGGCGATGATGTACAAGATCCAAATCTCGCTCTGCAAGATATCCGTCCTACTCTTCCTGCTGCGAATC
TTCCAGTCCCGTGTTTTCCGCGTATGCGCATATATACTCATCGCCATCAACGCCGCCATCGGCATCACGTTTTCC
CTCGTGGATCTGCTTCGCTGCGTGCCAGTCCACCTGGACTGGCATTCCTGGACCGGCGAATACGAGGGCGTGGGA
ACATGCATCAATTTCATCGCAGCAGTTTTAGTCCACTGTCTTGTCAACATTTTCGTCGACGTCGTCATCGTCCTC
CTACCGATCTACGAAGTCAGCAAGTTGCAGCTGCCATGGATGAAGAAGATCAACGTGGCACTGATGTTCATGATG
GGTCTTATTTTAACTATTATCGCTATCATTCGTGTGATCGTATTCTGGGAGAACCGCTGGACCACCAACTTGACC
GCCGGTCTCCAGCCCCTCATTCACTGGTCCGTCATCGAATCCCAGATCGCAATCATGACGACCTGTCTCCCCGCC
GCCCGCGCGTTCATAAACCAATACGTCCCAGGTCTTCCCGGCAGCACACAACGACGGACCTACGGCCGAACCAAC
TCTCTGTACAACAACGGAGGTGCATCCTCAGGGGTCACCAACAGCAAGATTTCCAAGTCAGTGAATATCTCCGTT
GACTATACGACACGGTCGGAGAGGGATTCGACCAGCGCTGTGCATTTGGTGGACATGGACGGGAGGTATGAACGG
TTTTAA
Gene >Ani_SJS100_1|g5754.t1
ATGAAGATACATCAGTGTTTAATCACCATATTGGCAGCGTTGACGGTATCTGTGTTCGCCGCGTCGTCAAATGGC
ACAGAATTCCCAGAGTGTGCGGTAAGTGGGATTCCCACCCGGGGGTTCCGCTTTCATCATTGACCATGTCCCCAG
GTGTCTTGTTTGCACCAAGAATCTCCAAATTGCACCATCACCGACGCATCATGTGTATGTACCGGCGATGCGAGC
AAGTCGTCGCTAGTGACTTGCGCACTATCGAACTGCAGTGCACTGGATTACTATAGTGAGCATCCATTTCCGCTG
GCACTGACGGTTTAATATACCTAACACCCCGCAGTCACGCGGCATATGTATGAACTGGAATGCGATCAGCCCATT
AAGAAGGGGCCCCCTCTTGTCGATCCTTCGACTCTTGCACCAGCTATCCTCGCCACGATATTCTTCTTTATCCGG
ATAGCTGCTAAACTCGCAAACCTCGCTGGTGGTTGGGGACTTGACGACCTCACTGTCACGATCGCATGGGTAAGT
GCTGCTGCATTGCCTGAGACCAGTGGAGCCTCTAACAGCTAGTAGATACTGGGAGTTGCCTTGTTTGTTGTGAAT
ACATACAGTAAGTCATTATCATCCTTCATTTCGTGGCATCATGACTGACAAAATAGTGATCAAATACGGTTTCGG
CATGAATACCTGGGATATCTTACCCTTCCACCACGTCACATTAGTCTTCCAGTACTTCGAAGGTCTGGCGATGAT
GTACAAGATCCAAATCTCGCTCTGCAAGATATCCGTCCTACTCTTCCTGCTGCGAATCTTCCAGTCCCGTGTTTT
CCGCGTATGCGCATATATACTCATCGCCATCAACGCCGCCATCGGCATCACGTTTTCCCTCGTGGATCTGCTTCG
CTGCGTGCCAGTCCACCTGGACTGGCATTCCTGGACCGGCGAATACGAGGGCGTGGGAACATGCATCAATTTCAT
CGCAGCAGTTTTAGTCCACTGTCTTGTCAACATTTTCGTCGACGTCGTCATCGTCCTCCTACCGATCTACGAAGT
CAGCAAGTTGCAGCTGCCATGGATGAAGAAGATCAACGTGGCACTGATGTTCATGATGGGTCTTATGTAAGGCTC
ACCTACTCATTCACCCCCTTCAAGCTTTGCTAACAAAGATCTTCTCAGTTTAACTATTATCGCTATCATTCGTGT
GATCGTATTCTGGGAGAACCGCTGGACCACCAACTTGACCGGTACCACCTCACCCACCCTCACAACCTTTTCAAA
GTCCACCCCACTAACACATAAATGTATTTACAGCCGGTCTCCAGCCCCTCATTCACTGGTCCGTCATCGAATCCC
AGATCGCAATCATGACGACCTGTCTCCCCGCCGCCCGCGCGTTCATAAACCAATACGTCCCAGGTCTTCCCGGCA
GCACACAACGACGGACCTACGGCCGAACCAACTCTCTGTACAACAACGGAGGTGCATCCTCAGGGGTCACCAACA
GCAAGATTTCCAAGTCAGTGAATATCTCCGTTGACTATACGACACGGTCGGAGAGGGATTCGACCAGCGCTGTGC
ATTTGGTGGACATGGACGGGAGGTATGAACGGTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail