Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5603.t1
Gene name
Locationscaffold_032:58750..60364
Strand+
Gene length (bp)1614
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 5.5E-12 172 257
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 3.2E-13 29 102

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006542 glutamine biosynthetic process Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0019752 carboxylic acid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0008152 metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0016874 ligase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0044249 cellular biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0009058 biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0008150 biological_process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0016053 organic acid biosynthetic process No
GO:0006541 glutamine metabolic process No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0016211 ammonia ligase activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5603.t1
MSSGEATVISNTENLMKYMTLDQRGTVQAEYIWIDAVGGCRSKTKTLSKPVTSVDELPEWNFDGSSTGQAPGDNS
DVYLRPVAIFPDPFRRGDNILVLCETWDSDGTPNKYNHRHEANRLMEIHAKEEWWFGLEQEYTLLGTDGWPYGWP
RGGFPGAQGPYYCGVGTGKVYCRDIVEAHYRACLYAGIKISGINAEVMPSQWEYQVGPCDGIEMGDHLWMSRFLL
HRVAEEFGVKISFDPKPIKGDWNGAGLHTNVSSASMRAEGGMKVIEAAMKKLEARHVEHIAVYGEGNEERLTGRH
ETGNIDKFSYGVADRGGSIRIPRQVAKDGKGYFEDRRPASNACPYQITGIIVETLMGGN*
Coding >Ani_SJS100_1|g5603.t1
ATGTCTTCTGGTGAAGCAACCGTCATCTCCAACACGGAGAATCTCATGAAGTACATGACCCTCGACCAGCGAGGT
ACCGTCCAGGCTGAGTACATCTGGATTGATGCTGTCGGTGGCTGCCGTAGCAAGACCAAGACTCTCTCCAAGCCT
GTCACATCGGTCGATGAGCTCCCCGAATGGAACTTTGACGGTTCGTCAACGGGTCAGGCCCCTGGTGACAACTCC
GATGTCTACCTCCGCCCCGTCGCTATCTTCCCCGATCCCTTCCGCCGTGGTGACAACATCCTCGTCCTCTGTGAG
ACCTGGGACTCCGATGGAACCCCCAACAAGTACAACCACCGCCACGAGGCCAACCGTCTGATGGAAATCCACGCC
AAGGAAGAATGGTGGTTCGGTCTGGAACAAGAATACACCCTCCTCGGCACTGATGGCTGGCCCTACGGATGGCCC
CGCGGTGGTTTCCCCGGTGCCCAGGGTCCTTACTACTGTGGTGTTGGTACCGGCAAGGTCTACTGCCGTGACATC
GTCGAGGCTCACTACCGTGCCTGCTTGTACGCCGGTATCAAGATCTCCGGTATCAACGCTGAGGTCATGCCTTCC
CAGTGGGAGTACCAGGTCGGCCCTTGCGACGGCATTGAGATGGGTGACCACCTTTGGATGTCCCGTTTCCTCCTC
CACCGTGTCGCTGAAGAGTTCGGTGTCAAGATCTCTTTCGACCCCAAGCCCATCAAGGGTGACTGGAACGGTGCC
GGTCTCCACACCAACGTCTCCTCCGCTTCGATGCGTGCTGAGGGCGGTATGAAGGTCATTGAGGCCGCCATGAAG
AAGCTTGAGGCCCGCCATGTTGAGCACATTGCTGTCTATGGTGAGGGTAACGAGGAGCGTCTCACTGGCCGTCAC
GAGACCGGCAACATCGACAAGTTCAGCTATGGTGTTGCCGACCGTGGTGGCTCCATCCGTATTCCCCGCCAGGTC
GCCAAGGACGGCAAGGGTTACTTCGAGGACCGTCGTCCCGCTAGTAACGCCTGCCCCTACCAGATCACCGGTATT
ATTGTTGAGACTCTCATGGGTGGCAACTAA
Transcript >Ani_SJS100_1|g5603.t1
ATGTCTTCTGGTGAAGCAACCGTCATCTCCAACACGGAGAATCTCATGAAGTACATGACCCTCGACCAGCGAGGT
ACCGTCCAGGCTGAGTACATCTGGATTGATGCTGTCGGTGGCTGCCGTAGCAAGACCAAGACTCTCTCCAAGCCT
GTCACATCGGTCGATGAGCTCCCCGAATGGAACTTTGACGGTTCGTCAACGGGTCAGGCCCCTGGTGACAACTCC
GATGTCTACCTCCGCCCCGTCGCTATCTTCCCCGATCCCTTCCGCCGTGGTGACAACATCCTCGTCCTCTGTGAG
ACCTGGGACTCCGATGGAACCCCCAACAAGTACAACCACCGCCACGAGGCCAACCGTCTGATGGAAATCCACGCC
AAGGAAGAATGGTGGTTCGGTCTGGAACAAGAATACACCCTCCTCGGCACTGATGGCTGGCCCTACGGATGGCCC
CGCGGTGGTTTCCCCGGTGCCCAGGGTCCTTACTACTGTGGTGTTGGTACCGGCAAGGTCTACTGCCGTGACATC
GTCGAGGCTCACTACCGTGCCTGCTTGTACGCCGGTATCAAGATCTCCGGTATCAACGCTGAGGTCATGCCTTCC
CAGTGGGAGTACCAGGTCGGCCCTTGCGACGGCATTGAGATGGGTGACCACCTTTGGATGTCCCGTTTCCTCCTC
CACCGTGTCGCTGAAGAGTTCGGTGTCAAGATCTCTTTCGACCCCAAGCCCATCAAGGGTGACTGGAACGGTGCC
GGTCTCCACACCAACGTCTCCTCCGCTTCGATGCGTGCTGAGGGCGGTATGAAGGTCATTGAGGCCGCCATGAAG
AAGCTTGAGGCCCGCCATGTTGAGCACATTGCTGTCTATGGTGAGGGTAACGAGGAGCGTCTCACTGGCCGTCAC
GAGACCGGCAACATCGACAAGTTCAGCTATGGTGTTGCCGACCGTGGTGGCTCCATCCGTATTCCCCGCCAGGTC
GCCAAGGACGGCAAGGGTTACTTCGAGGACCGTCGTCCCGCTAGTAACGCCTGCCCCTACCAGATCACCGGTATT
ATTGTTGAGACTCTCATGGGTGGCAACTAA
Gene >Ani_SJS100_1|g5603.t1
ATGGTATGTCCTTTCAATGCTATACTCCCAATCTGTTACTTTGGCTTCAGTTGCGTTGTTTGCCTGCCAAGATTT
GCTAGAACTTACTCGCTGACTCACACTTTTTCGCCACAGTCTTCTGGTGAAGCAACCGTCATCTCCAACACGGAG
AATGTGCGTTCATCTTCTCATTAATACCTTGCATAATCTTTCTTCAGCCGCTTTGCGGTTCTGAGGAAAATGCCA
TACTGACTGGCTGGAAACAGCTCATGAAGTACATGACCCTCGACCAGCGAGGTACCGTCCAGGCTGAGTACATCT
GGATTGATGCTGTCGGTGGCTGCCGTAGCAAGACCAAGGTAAGCACTTTTCTTCCATTCACTCGACTTTCTTCAT
TCATGGCACACGCGTGTGGAGTCGGACGTGTCCTGGATTGCGACGAGGGACCCGTCGTTATCATCGCTCCCTCGA
ACACCGATAAGCCCTGCGCACGGTGACTCGATCCTGCACGCGCCGGCTGCACCCACCCGTTGCACGTGACATAGC
GCGTCTCGGGCTAACCCATCATTGTGCTTTAGACTCTCTCCAAGCCTGTCACATCGGTCGATGAGCTCCCCGAAT
GGAACTTTGACGGTTCGTCAACGGGTCAGGCCCCTGGTGACAACTCCGATGTCTACCTCCGCCCCGTCGCTATCT
TCCCCGATCCCTTCCGCCGTGGTGACAACATCCTCGTCCTCTGTGAGACCTGGGACTCCGATGGAACCCCCAACA
AGTACAACCACCGCCACGAGGCCAACCGTCTGATGGAAATCCACGCCAAGGAAGAATGGTGGTTCGGTCTGGAAC
AAGAATACACCCTCCTCGGCACTGATGGCTGGCCCTACGGATGGCCCCGCGGTGGTTTCCCCGGTGCCCAGGGTC
CTTACTACTGTGGTGTTGGTACCGGCAAGGTCTACTGCCGTGACATCGTCGAGGCTCACTACCGTGCCTGCTTGT
ACGCCGGTATCAAGATCTCCGGTATCAACGCTGAGGTCATGCCTTCCCAGTGGGAGTACCAGGTCGGCCCTTGCG
ACGGCATTGAGAGTGAGTTGGCCCTCGCCAGTTGCTATTTGGAGTGCATTAATACTAACTGTGTTTGCAGTGGGT
GACCACCTTTGGATGTCCCGTTTCCTCCTCCACCGTGTCGCTGAAGAGTTCGGTGTCAAGATCTCTTTCGACCCC
AAGCCCATCAAGGGTGACTGGAACGGTGCCGGTCTCCACACCAACGTCTCCTCCGCTTCGATGCGTGCTGAGGGC
GGTATGAAGGTCATTGAGGCCGCCATGAAGAAGCTTGAGGCCCGCCATGTTGAGCACATTGCTGTCTATGGTGAG
GGTAACGAGGAGCGTCTCACTGGCCGTCACGAGACCGGCAACATCGACAAGTTCAGCTATGGTGTTGCCGACCGT
GGTGGCTCCATCCGTATTCCCCGCCAGGTCGCCAAGGACGGCAAGGGTTACTTCGAGGACCGTCGTCCCGCTAGT
AACGCCTGCCCCTACCAGATCACCGGTATTATTGTTGAGACTGTAAGTTCTACTGAGTTTTACATGGATCACGCA
GATGACTGACTGTTTTTCCAGCTCATGGGTGGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail