Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5578.t1
Gene name
Locationscaffold_031:337117..338765
Strand-
Gene length (bp)1648
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 1.4E-23 2 202
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 6.0E-15 6 211
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.0E-14 2 244
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 1.3E-11 74 205
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.7E-05 6 48

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0043168 anion binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 467 489 22
2 496 518 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5578.t1
MKRVAIVGAGPCGLVALKEMLQAGLDATIYESSNQLGGLFATAMAYPNLHLTISNRAMAFSDFPDPSRMRCSTAR
DYLLYLQDYARHFDLERHIRYRSEVCKATRGDDKQWNLSIKQTRDDENDESIIQLQADALIVATGGSQVPNDVPS
QLAGFEGKIIHSNAYDKYFMREVAEKKLRVLIVGGGESGADISADLCELSPNLTVWLRRPPCVAIRYLNRLDEMQ
QMRANQTVDFPVSIFLEAITTNRLGAAQNVYLYSLFRRAVFYNGLIMSTRERWFLERLATAFLRSDQSTVITKSS
RMCQALDKEKLEALITPFVSVSGRTCEFSLPDGTRQRREFDAILLCHGFRLEFPWLQLPDGIPFSPNPRSWFLHC
FPEGLGDCLFFLGYARPGQGGIPPVAEMLSRYIALLLRDEKRLPADYAEQAQKDEAAEREYYYISPEVNSLVDYN
AFMESVARRIGCETRMPLSCVIFFNLHILTVAFLALRWFSTTLIPFSISTLLMLGGCIPTGAYGTATVARVPILP
YSQRF*
Coding >Ani_SJS100_1|g5578.t1
ATGAAAAGAGTGGCCATCGTTGGAGCTGGGCCCTGTGGCTTAGTAGCATTGAAAGAGATGCTGCAAGCAGGTCTC
GACGCAACCATATATGAAAGTTCCAATCAGCTGGGTGGTCTGTTCGCCACAGCAATGGCTTATCCGAACCTCCAC
CTCACGATCTCCAACAGGGCGATGGCTTTCTCGGACTTTCCTGATCCATCTCGCATGCGATGTTCCACGGCCAGG
GATTATTTGCTATATCTGCAAGATTATGCTCGCCATTTCGATCTCGAACGTCATATCAGGTATCGCTCGGAAGTT
TGTAAGGCCACTCGCGGAGACGATAAACAATGGAATCTGTCGATCAAGCAGACAAGAGACGATGAGAACGATGAA
TCCATCATTCAATTGCAGGCAGACGCCCTTATTGTTGCAACAGGGGGTAGCCAAGTTCCGAATGATGTACCTTCA
CAGCTGGCGGGATTCGAGGGCAAGATTATCCATTCCAACGCGTACGACAAATATTTTATGCGGGAAGTCGCGGAA
AAGAAGCTTAGGGTCCTGATCGTAGGAGGCGGCGAAAGCGGTGCCGATATCTCAGCAGACCTTTGTGAGTTGTCG
CCTAATCTGACGGTTTGGTTGCGACGTCCACCCTGTGTGGCCATTCGCTACCTTAACAGGCTTGATGAGATGCAA
CAAATGAGAGCCAACCAAACCGTGGACTTCCCGGTCAGCATCTTCCTCGAAGCCATCACTACAAATCGCCTGGGT
GCAGCACAAAACGTTTATCTTTATAGCTTGTTCCGTCGTGCCGTCTTCTATAATGGCCTAATCATGTCCACAAGA
GAGCGCTGGTTTTTGGAAAGGTTGGCAACGGCGTTCCTCCGCAGTGATCAATCCACAGTTATCACGAAAAGTTCG
CGAATGTGTCAGGCTTTAGACAAAGAGAAATTAGAAGCATTAATAACCCCGTTTGTCTCTGTTAGTGGGCGGACC
TGTGAATTTAGCCTTCCAGATGGGACAAGGCAACGGCGCGAGTTTGATGCCATCTTGCTTTGTCATGGCTTCCGA
TTGGAATTTCCTTGGCTTCAGCTCCCTGACGGTATTCCCTTCTCGCCTAACCCACGATCATGGTTCCTGCATTGC
TTCCCCGAGGGGCTGGGCGACTGTCTTTTCTTTTTGGGCTATGCACGGCCTGGCCAGGGAGGCATTCCTCCTGTT
GCCGAGATGCTGAGCCGATATATCGCACTGTTGCTGCGTGACGAAAAACGGCTTCCCGCGGATTATGCAGAACAA
GCACAGAAAGATGAGGCAGCCGAGCGCGAGTATTACTATATCAGTCCTGAAGTCAATTCGCTGGTTGATTATAAT
GCTTTTATGGAAAGTGTGGCACGAAGGATAGGGTGTGAGACCCGAATGCCGCTTTCCTGCGTGATCTTCTTCAAT
CTTCATATTCTAACCGTTGCTTTTCTGGCCCTTCGCTGGTTCTCGACAACATTGATCCCATTCAGTATTTCGACT
TTGCTGATGCTTGGTGGCTGTATCCCCACTGGGGCGTATGGTACCGCTACCGTGGCCCGGGTGCCAATCCTGCCC
TACTCACAGCGCTTCTGA
Transcript >Ani_SJS100_1|g5578.t1
ATGAAAAGAGTGGCCATCGTTGGAGCTGGGCCCTGTGGCTTAGTAGCATTGAAAGAGATGCTGCAAGCAGGTCTC
GACGCAACCATATATGAAAGTTCCAATCAGCTGGGTGGTCTGTTCGCCACAGCAATGGCTTATCCGAACCTCCAC
CTCACGATCTCCAACAGGGCGATGGCTTTCTCGGACTTTCCTGATCCATCTCGCATGCGATGTTCCACGGCCAGG
GATTATTTGCTATATCTGCAAGATTATGCTCGCCATTTCGATCTCGAACGTCATATCAGGTATCGCTCGGAAGTT
TGTAAGGCCACTCGCGGAGACGATAAACAATGGAATCTGTCGATCAAGCAGACAAGAGACGATGAGAACGATGAA
TCCATCATTCAATTGCAGGCAGACGCCCTTATTGTTGCAACAGGGGGTAGCCAAGTTCCGAATGATGTACCTTCA
CAGCTGGCGGGATTCGAGGGCAAGATTATCCATTCCAACGCGTACGACAAATATTTTATGCGGGAAGTCGCGGAA
AAGAAGCTTAGGGTCCTGATCGTAGGAGGCGGCGAAAGCGGTGCCGATATCTCAGCAGACCTTTGTGAGTTGTCG
CCTAATCTGACGGTTTGGTTGCGACGTCCACCCTGTGTGGCCATTCGCTACCTTAACAGGCTTGATGAGATGCAA
CAAATGAGAGCCAACCAAACCGTGGACTTCCCGGTCAGCATCTTCCTCGAAGCCATCACTACAAATCGCCTGGGT
GCAGCACAAAACGTTTATCTTTATAGCTTGTTCCGTCGTGCCGTCTTCTATAATGGCCTAATCATGTCCACAAGA
GAGCGCTGGTTTTTGGAAAGGTTGGCAACGGCGTTCCTCCGCAGTGATCAATCCACAGTTATCACGAAAAGTTCG
CGAATGTGTCAGGCTTTAGACAAAGAGAAATTAGAAGCATTAATAACCCCGTTTGTCTCTGTTAGTGGGCGGACC
TGTGAATTTAGCCTTCCAGATGGGACAAGGCAACGGCGCGAGTTTGATGCCATCTTGCTTTGTCATGGCTTCCGA
TTGGAATTTCCTTGGCTTCAGCTCCCTGACGGTATTCCCTTCTCGCCTAACCCACGATCATGGTTCCTGCATTGC
TTCCCCGAGGGGCTGGGCGACTGTCTTTTCTTTTTGGGCTATGCACGGCCTGGCCAGGGAGGCATTCCTCCTGTT
GCCGAGATGCTGAGCCGATATATCGCACTGTTGCTGCGTGACGAAAAACGGCTTCCCGCGGATTATGCAGAACAA
GCACAGAAAGATGAGGCAGCCGAGCGCGAGTATTACTATATCAGTCCTGAAGTCAATTCGCTGGTTGATTATAAT
GCTTTTATGGAAAGTGTGGCACGAAGGATAGGGTGTGAGACCCGAATGCCGCTTTCCTGCGTGATCTTCTTCAAT
CTTCATATTCTAACCGTTGCTTTTCTGGCCCTTCGCTGGTTCTCGACAACATTGATCCCATTCAGTATTTCGACT
TTGCTGATGCTTGGTGGCTGTATCCCCACTGGGGCGTATGGTACCGCTACCGTGGCCCGGGTGCCAATCCTGCCC
TACTCACAGCGCTTCTGA
Gene >Ani_SJS100_1|g5578.t1
ATGAAAAGAGTGGCCATCGTTGGAGCTGGGCCCTGTGGCTTAGTAGCATTGAAAGAGATGCTGCAAGCAGGTCTC
GACGCAACCATATATGAAAGTTCCAATCAGCTGGGTGGTCTGTTCGCCACAGCAATGGCTTATCCGAACCTCCAC
CTCACGATCTCCAACAGGGCGATGGCTTTCTCGGACTTTCCTGATCCATCTCGCATGCGATGTTCCACGGCCAGG
GATTATTTGCTATATCTGCAAGATTATGCTCGCCATTTCGATCTCGAACGTCATATCAGGTATCGCTCGGAAGTT
TGTAAGGCCACTCGCGGAGACGATAAACAATGGAATCTGTCGATCAAGCAGACAAGAGACGATGAGAACGATGAA
TCCATCATTCAATTGCAGGCAGACGCCCTTATTGTTGCAACAGGGGGTAGCCAAGTTCCGAATGATGTACCTTCA
CAGCTGGCGGGATTCGAGGGCAAGATTATCCATTCCAACGCGTACGACAAATATTTTATGCGGGAAGTCGCGGAA
AAGAAGCTTAGGGTCCTGATCGTAGGAGGCGGCGAAAGCGGTGCCGATATCTCAGCAGACCTTTGTGAGTTGTCG
CCTAATCTGACGGTTTGGTTGCGACGTCCACCCTGTGTGGCCATTCGCTACCTTAACAGGCTTGATGAGATGCAA
CAAATGAGAGCCAACCAAACCGTGGACTTCCCGGTCAGCATCTTCCTCGAAGCCATCACTACAAATCGCCTGGGT
GCAGCACAAAACGTTTATCTTTATAGCTTGTTCCGTCGTGCCGTCTTCTATAATGGCCTAATCATGTCCACAAGA
GAGCGCTGGTTTTTGGAAAGGTTGGCAACGGCGTTCCTCCGCAGTGATCAATCCACAGTTATCACGAAAAGTTCG
CGAATGTGTCAGGCTTTAGACAAAGAGAAATTAGAAGCATTAATAACCCCGTTTGTCTCTGTTAGTGGGCGGACC
TGTGAATTTAGCCTTCCAGATGGGACAAGGCAACGGCGCGAGTTTGATGCCATCTTGCTTTGTCATGGCTTCCGA
TTGGAATTTCCTTGGCTTCAGCTCCCTGACGGTATTCCCTTCTCGCCTAACCCACGATCATGGTTCCTGCATTGC
TTCCCCGAGGGGCTGGGCGACTGTCTTTTCTTTTTGGGCTATGCACGGCCTGGCCAGGGAGGCATTCCTCCTGTT
GCCGAGATGCTGAGCCGATATATCGCACTGTTGCTGCGTGACGAAAAACGGCTTCCCGCGGATTATGCAGAACAA
GCACAGAAAGATGAGGCAGCCGAGCGCGAGTATTACTATATCAGTCCTGAAGTCAATTCGCTGGTTGATTATAAT
GCTTTTATGGAAAGTGTGGCACGAAGGATAGGGTGTGAGACCCGAATGCCGCTTTCCTGCGTGATCTTCTTCAAT
CTTCATATTCTAACCGTTGCTTTTCTGGCCCTTCGCTGGTTCTCGACAACATTGATCCCATTCAGTATTTCGACT
TTGCTGATGCTGTGGGTTGGAACAGCCATCGGACTATGCATGCTTCATGATGGACTCCTCCTCAAGTGGTGGCTG
TATCCCCACTGGGGCGTATGGTACCGCTACCGTGGCCCGGGTGCCAATCCTGCCCTACTCACAGCGCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail