Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5507.t1
Gene name
Locationscaffold_031:113257..114968
Strand+
Gene length (bp)1711
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 1.3E-34 19 464

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0015298 solute:cation antiporter activity No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0015297 antiporter activity No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0022804 active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006811 ion transport No
GO:0005215 transporter activity No
GO:0015291 secondary active transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 39 61 22
3 66 88 22
4 95 117 22
5 132 154 22
6 161 183 22
7 205 227 22
8 248 270 22
9 320 342 22
10 349 371 22
11 440 462 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5507.t1
MAGGFLPYHEPGIVNILILISFFFFLSLAEWISSKIIRAGIIGQIAVGIIYGTPLANILHADWQSTFLALGYIGL
ILIIFEGGLGARLDLLKKNFFLSMIGAATGVLFPIGLSYLLLYLGFGYGAVETFIVGASLSATSLGTTFAVISTA
SSTVDLAQTRVGSILVSAAVIDDVVGLVMLSVINDLGELGQGHSVNLGWLIGRPIVASIGMAIVTPLVTKFLFAP
LFRRYIEYHFARFDHISNIILMILVLCAFISIAAYTGTSILFGAFLAGTFLTYIPSKHPDGPFVVMSREEGEREE
NKSPTFVHTFERYLLDVQKYLMEPLFFSSIGFAIPFVQLWTGKRIWRGIVFTLLMLFAKLIVGIWVPLWQLLSGS
NILSRKVAKEYPREEYHSDESTKPVWSTVCLSGLLLGSAMVARGEIGLLIVEVGYNETSYVSEDAFITAVWAILL
NTVLGPVTVGLLMKFHGKEIGEGAWGLQGTAPAAGDDSSIDPSLG*
Coding >Ani_SJS100_1|g5507.t1
ATGGCTGGAGGTTTCCTCCCATATCACGAACCAGGCATTGTCAACATTCTCATCCTAATCTCCTTCTTTTTCTTC
CTCTCACTAGCGGAATGGATCTCCTCCAAAATCATCCGCGCCGGCATCATTGGCCAGATCGCCGTCGGTATCATC
TACGGAACGCCACTGGCAAACATCCTGCATGCAGACTGGCAATCCACTTTCCTTGCTCTAGGTTATATCGGCTTA
ATACTCATCATCTTTGAAGGCGGGCTAGGAGCCCGTCTTGACCTCCTGAAGAAGAATTTCTTCTTGAGTATGATT
GGCGCTGCAACAGGGGTTCTATTTCCGATCGGACTTTCTTACCTGCTCTTGTACTTGGGATTCGGTTATGGTGCT
GTTGAAACCTTCATCGTGGGAGCATCTTTGTCTGCTACTTCTCTCGGCACTACCTTTGCTGTTATTTCAACCGCT
TCCAGCACGGTCGATCTCGCCCAAACTCGCGTCGGATCGATCCTCGTAAGCGCAGCTGTCATTGACGACGTTGTC
GGTCTGGTAATGCTAAGCGTCATCAATGATCTGGGCGAACTAGGCCAAGGCCACTCTGTCAATCTAGGCTGGCTA
ATTGGCCGCCCGATTGTAGCCTCCATCGGCATGGCTATTGTAACCCCTCTGGTAACAAAATTCCTCTTTGCGCCG
CTCTTCCGCCGCTATATCGAGTATCACTTCGCTCGATTCGACCACATCTCCAACATCATCCTGATGATCTTGGTC
CTCTGCGCATTTATCAGCATTGCCGCGTATACGGGGACTTCCATCCTCTTTGGTGCGTTCCTGGCTGGTACATTC
CTGACTTATATTCCCAGTAAGCACCCAGATGGACCGTTTGTAGTCATGAGCCGAGAGGAAGGCGAAAGAGAGGAG
AATAAGAGTCCGACATTTGTACACACTTTCGAGCGGTACCTGCTGGATGTGCAGAAGTATCTTATGGAGCCTCTC
TTCTTTTCGAGTATCGGGTTCGCTATCCCCTTTGTGCAGCTTTGGACAGGGAAGAGGATATGGAGGGGTATTGTC
TTTACTCTTCTGATGCTTTTTGCAAAGCTCATCGTTGGAATCTGGGTCCCACTTTGGCAATTACTATCCGGTTCC
AACATCCTGAGCAGAAAAGTAGCAAAAGAGTATCCTAGGGAAGAATATCACAGCGACGAGAGCACAAAACCAGTC
TGGTCTACAGTCTGTCTCTCCGGCCTACTTCTCGGCTCGGCAATGGTTGCCCGCGGCGAGATCGGCCTCCTCATT
GTCGAGGTCGGGTACAATGAGACTTCATACGTGAGTGAGGACGCCTTTATTACCGCCGTATGGGCGATTCTGCTT
AACACGGTCCTTGGTCCTGTAACTGTGGGGCTGCTGATGAAGTTTCATGGAAAGGAGATAGGGGAGGGGGCATGG
GGGCTTCAGGGGACTGCTCCTGCTGCTGGTGACGATTCAAGTATTGATCCCTCACTTGGGTGA
Transcript >Ani_SJS100_1|g5507.t1
ATGGCTGGAGGTTTCCTCCCATATCACGAACCAGGCATTGTCAACATTCTCATCCTAATCTCCTTCTTTTTCTTC
CTCTCACTAGCGGAATGGATCTCCTCCAAAATCATCCGCGCCGGCATCATTGGCCAGATCGCCGTCGGTATCATC
TACGGAACGCCACTGGCAAACATCCTGCATGCAGACTGGCAATCCACTTTCCTTGCTCTAGGTTATATCGGCTTA
ATACTCATCATCTTTGAAGGCGGGCTAGGAGCCCGTCTTGACCTCCTGAAGAAGAATTTCTTCTTGAGTATGATT
GGCGCTGCAACAGGGGTTCTATTTCCGATCGGACTTTCTTACCTGCTCTTGTACTTGGGATTCGGTTATGGTGCT
GTTGAAACCTTCATCGTGGGAGCATCTTTGTCTGCTACTTCTCTCGGCACTACCTTTGCTGTTATTTCAACCGCT
TCCAGCACGGTCGATCTCGCCCAAACTCGCGTCGGATCGATCCTCGTAAGCGCAGCTGTCATTGACGACGTTGTC
GGTCTGGTAATGCTAAGCGTCATCAATGATCTGGGCGAACTAGGCCAAGGCCACTCTGTCAATCTAGGCTGGCTA
ATTGGCCGCCCGATTGTAGCCTCCATCGGCATGGCTATTGTAACCCCTCTGGTAACAAAATTCCTCTTTGCGCCG
CTCTTCCGCCGCTATATCGAGTATCACTTCGCTCGATTCGACCACATCTCCAACATCATCCTGATGATCTTGGTC
CTCTGCGCATTTATCAGCATTGCCGCGTATACGGGGACTTCCATCCTCTTTGGTGCGTTCCTGGCTGGTACATTC
CTGACTTATATTCCCAGTAAGCACCCAGATGGACCGTTTGTAGTCATGAGCCGAGAGGAAGGCGAAAGAGAGGAG
AATAAGAGTCCGACATTTGTACACACTTTCGAGCGGTACCTGCTGGATGTGCAGAAGTATCTTATGGAGCCTCTC
TTCTTTTCGAGTATCGGGTTCGCTATCCCCTTTGTGCAGCTTTGGACAGGGAAGAGGATATGGAGGGGTATTGTC
TTTACTCTTCTGATGCTTTTTGCAAAGCTCATCGTTGGAATCTGGGTCCCACTTTGGCAATTACTATCCGGTTCC
AACATCCTGAGCAGAAAAGTAGCAAAAGAGTATCCTAGGGAAGAATATCACAGCGACGAGAGCACAAAACCAGTC
TGGTCTACAGTCTGTCTCTCCGGCCTACTTCTCGGCTCGGCAATGGTTGCCCGCGGCGAGATCGGCCTCCTCATT
GTCGAGGTCGGGTACAATGAGACTTCATACGTGAGTGAGGACGCCTTTATTACCGCCGTATGGGCGATTCTGCTT
AACACGGTCCTTGGTCCTGTAACTGTGGGGCTGCTGATGAAGTTTCATGGAAAGGAGATAGGGGAGGGGGCATGG
GGGCTTCAGGGGACTGCTCCTGCTGCTGGTGACGATTCAAGTATTGATCCCTCACTTGGGTGA
Gene >Ani_SJS100_1|g5507.t1
ATGGCTGGAGGTTTCCTCCCATATCACGAACCAGGCAGTACGTTGACGATGCCTTCACCACTGCCATTATCATTA
AAAACTGACCACATCAGTTGTCAACATTCTCATCCTAATCTCCTTCTTTTTCTTCCTCTCACTAGCGGAATGGAT
CTCCTCCAAAATCATCCGCGCCGGCATCATTGGCCAGATCGCCGTCGGTATCATCTACGGAACGCCACTGGCAAA
CATCCTGCATGCAGACTGGCAATCCACTTTCCTTGCTCTAGGTTATATCGGCTTAATACTCATCATCTTTGAAGG
CGGGCTAGGAGCCCGTCTTGACCTCCTGAAGAAGAATTTCTTCTTGAGTATGATTGGCGCTGCAACAGGGGTTCT
ATTTCCGATCGGACTTTCTTACCTGCTCTTGTACTTGGGATTCGGTTATGGTGAGTATGCGTTACTCGATTAGGA
CTCTCAAAAGTGACACATCCCGGCAGGTGCTGTTGAAACCTTCATCGTGGGAGCATCTTTGTCTGCTACTTCTCT
CGGCACTACCTTTGCTGTTATTTCAACCGCTTCCAGCACGGTCGATCTCGCCCAAACTCGCGTCGGATCGATCCT
CGTAAGCGCAGCTGTCATTGACGACGTTGTCGGTCTGGTAATGCTAAGGTAGATGACATACTTGCCTGAAACCCA
CCTTCATCACGGTTTAACTCATTTGATACAGCGTCATCAATGATCTGGGCGAACTAGGCCAAGGCCACTCTGTCA
ATCTAGGCTGGCTAATTGGCCGCCCGATTGTAGCCTCCATCGGCATGGCTATTGTAACCCCTCTGGTAACAAAAT
TCCTCTTTGCGCCGCTCTTCCGCCGCTATATCGAGTATCACTTCGCTCGATTCGACCACATCTCCAACATCATCC
TGATGATCTTGGTCCTCTGCGCATTTATCAGCATTGCCGCGTATACGGGGACTTCCATCCTCTTTGGTGCGTTCC
TGGCTGGTACATTCCTGACTTATATTCCCAGTAAGCACCCAGATGGACCGTTTGTAGTCATGAGCCGAGAGGAAG
GCGAAAGAGAGGAGAATAAGAGTCCGACATTTGTACACACTTTCGAGCGGTACCTGCTGGATGTGCAGAAGTATC
TTATGGAGCCTCTCTTCTTTTCGAGTATCGGGTTCGCTATCCCCTTTGTGCAGCTTTGGACAGGGAAGAGGATAT
GGAGGGGTATTGTCTTTACTCTTCTGATGCTTTTTGCAAAGGTATTCACTTTCCACTCTCGCTAATTTTGTCTCT
AACATGACAACTAACAATGAACCAGCTCATCGTTGGAATCTGGGTCCCACTTTGGCAATTACTATCCGGTTCCAA
CATCCTGAGCAGAAAAGTAGCAAAAGAGTATCCTAGGGAAGAATATCACAGCGACGAGAGCACAAAACCAGTCTG
GTCTACAGTCTGTCTCTCCGGCCTACTTCTCGGCTCGGCAATGGTTGCCCGCGGCGAGATCGGCCTCCTCATTGT
CGAGGTCGGGTACAATGAGACTTCATACGTGAGTGAGGACGCCTTTATTACCGCCGTATGGGCGATTCTGCTTAA
CACGGTCCTTGGTCCTGTAACTGTGGGGCTGCTGATGAAGTTTCATGGAAAGGAGATAGGGGAGGGGGCATGGGG
GCTTCAGGGGACTGCTCCTGCTGCTGGTGACGATTCAAGTATTGATCCCTCACTTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail