Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5504.t1
Gene name
Locationscaffold_031:99791..100659
Strand-
Gene length (bp)868
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.6E-14 5 83
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 3.6E-14 8 86
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 2.8E-12 18 84
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.2E-10 142 205
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 3.9E-08 136 200
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 9.1E-08 144 208

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0006575 cellular modified amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043603 cellular amide metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5504.t1
MSRPDITLYTAQTPNGIKISIALEELGLPYKVEKIDISKNTQKEPWFLEINPNGRIPALTDTFTDGSKIRLFESG
SILTYLAEQYDKDHKISYPQGTREYYEQNSWLYFQNAGVGPMQGQANHFHRYAPERIEYGVNRYINETRRLYSVL
DAHLAKSKSGYLVGDHVSIADISHWGWVAAAGWAGVDIEEFPNLKAWEERMAAREGVEKGRHVPSPHTIKELLKD
KAKAEKIAEESKGWIQQGMKADAKH*
Coding >Ani_SJS100_1|g5504.t1
ATGAGCCGCCCGGACATTACCCTGTACACTGCGCAGACTCCCAATGGGATTAAGATTTCCATTGCGCTGGAGGAG
CTTGGTCTGCCCTACAAAGTCGAGAAGATTGACATCTCCAAGAACACCCAGAAAGAGCCATGGTTCCTCGAAATC
AACCCCAACGGCCGCATCCCCGCCTTAACCGACACCTTCACGGATGGGTCCAAGATCCGGCTTTTCGAATCCGGC
AGCATCCTCACCTACCTGGCGGAACAATACGACAAAGACCACAAGATCTCCTACCCCCAGGGAACCCGCGAATAC
TACGAACAGAACAGCTGGCTCTACTTCCAGAACGCCGGTGTCGGGCCCATGCAAGGCCAAGCGAACCACTTCCAC
CGGTACGCGCCCGAGCGCATCGAGTACGGCGTGAACCGCTACATCAACGAGACACGACGTCTATACAGTGTGCTG
GATGCGCACCTCGCCAAGTCGAAGTCTGGGTATCTTGTTGGTGATCACGTCAGTATTGCGGATATTTCGCATTGG
GGATGGGTTGCGGCGGCCGGGTGGGCGGGAGTTGATATTGAGGAGTTCCCGAATCTGAAGGCGTGGGAGGAGCGC
ATGGCTGCTAGGGAGGGCGTTGAGAAGGGTAGGCATGTGCCGAGTCCGCATACTATTAAGGAGCTCTTGAAGGAT
AAGGCCAAGGCGGAGAAGATTGCGGAGGAGTCGAAGGGGTGGATTCAGCAGGGGATGAAGGCGGATGCTAAGCAT
TAG
Transcript >Ani_SJS100_1|g5504.t1
ATGAGCCGCCCGGACATTACCCTGTACACTGCGCAGACTCCCAATGGGATTAAGATTTCCATTGCGCTGGAGGAG
CTTGGTCTGCCCTACAAAGTCGAGAAGATTGACATCTCCAAGAACACCCAGAAAGAGCCATGGTTCCTCGAAATC
AACCCCAACGGCCGCATCCCCGCCTTAACCGACACCTTCACGGATGGGTCCAAGATCCGGCTTTTCGAATCCGGC
AGCATCCTCACCTACCTGGCGGAACAATACGACAAAGACCACAAGATCTCCTACCCCCAGGGAACCCGCGAATAC
TACGAACAGAACAGCTGGCTCTACTTCCAGAACGCCGGTGTCGGGCCCATGCAAGGCCAAGCGAACCACTTCCAC
CGGTACGCGCCCGAGCGCATCGAGTACGGCGTGAACCGCTACATCAACGAGACACGACGTCTATACAGTGTGCTG
GATGCGCACCTCGCCAAGTCGAAGTCTGGGTATCTTGTTGGTGATCACGTCAGTATTGCGGATATTTCGCATTGG
GGATGGGTTGCGGCGGCCGGGTGGGCGGGAGTTGATATTGAGGAGTTCCCGAATCTGAAGGCGTGGGAGGAGCGC
ATGGCTGCTAGGGAGGGCGTTGAGAAGGGTAGGCATGTGCCGAGTCCGCATACTATTAAGGAGCTCTTGAAGGAT
AAGGCCAAGGCGGAGAAGATTGCGGAGGAGTCGAAGGGGTGGATTCAGCAGGGGATGAAGGCGGATGCTAAGCAT
TAG
Gene >Ani_SJS100_1|g5504.t1
ATGAGCCGCCCGGACATTACCCTGTACACTGCGCAGACTCCCAATGGGATTAAGATTTCCATTGCGCTGGAGGAG
CTTGGGTATGCCAAACATACACCTTCCTGGGATAATCGGCAATTGACTAAAGCGATAATCCAGTCTGCCCTACAA
AGTCGAGAAGATTGACATCTCCAAGAACACCCAGAAAGAGCCGTATGCTCCCTAACCCCCTTCCTCACATCAACT
CACCACCACTAACCACCAACACAGATGGTTCCTCGAAATCAACCCCAACGGCCGCATCCCCGCCTTAACCGACAC
CTTCACGGATGGGTCCAAGATCCGGCTTTTCGAATCCGGCAGCATCCTCACCTACCTGGCGGAACAATACGACAA
AGACCACAAGATCTCCTACCCCCAGGGAACCCGCGAATACTACGAACAGAACAGCTGGCTCTACTTCCAGAACGC
CGGTGTCGGGCCCATGCAAGGCCAAGCGAACCACTTCCACCGGTACGCGCCCGAGCGCATCGAGTACGGCGTGAA
CCGCTACATCAACGAGACACGACGTCTATACAGTGTGCTGGATGCGCACCTCGCCAAGTCGAAGTCTGGGTATCT
TGTTGGTGATCACGTCAGTATTGCGGATATTTCGCATTGGGGATGGGTTGCGGCGGCCGGGTGGGCGGGAGTTGA
TATTGAGGAGTTCCCGAATCTGAAGGCGTGGGAGGAGCGCATGGCTGCTAGGGAGGGCGTTGAGAAGGGTAGGCA
TGTGCCGAGTCCGCATACTATTAAGGAGCTCTTGAAGGATAAGGCCAAGGCGGAGAAGATTGCGGAGGAGTCGAA
GGGGTGGATTCAGCAGGGGATGAAGGCGGATGCTAAGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail