Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g540.t1
Gene name
Locationscaffold_002:268394..271915
Strand-
Gene length (bp)3521
Transcript length (bp)3069
Coding sequence length (bp)3069
Protein length (aa) 1023

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11496 HDA2-3 Class II histone deacetylase complex subunits 2 and 3 2.3E-65 386 656

GO

GO Term Description Terminal node
GO:0070823 HDA1 complex Yes
GO:0016575 histone deacetylation Yes
GO:0008152 metabolic process No
GO:0035601 protein deacylation No
GO:0016570 histone modification No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0043412 macromolecule modification No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0098732 macromolecule deacylation No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0006476 protein deacetylation No
GO:0036211 protein modification process No
GO:0000118 histone deacetylase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g540.t1
MSRKRKASSTIYTSHGSHKRKKRWRYQHVVHSSDTETDNDSEALGADEWLINCILDESESQYLIDWEGPWTPTWE
PKENANDVAVQVWEDKKRRYQVQEEFVRYSPQPPLPLFYPALNQNLVLPSHPPQSDIDNLLNPEVLPTARATEVP
AIFSTPREPRVSDEVEETPTTPCRAGNTGTPNVAEGIPETPHNESSAAPANIPELLPANPAEGADEIPEPPPGLV
DEPQLFRRASTVPESIAVNIGQLISSISRPSMDTQEKEGPSLSETMEKYSQFEGSTPREKLRNAYAQLRAKANPG
PESSATPSSAGDIEPSAPVSIPETTAPLSVRVDKEPTHPKDNEANQDTTIPPVEPEEIGPPQTIQPSALSMHFAE
EPTPGSVHLGPSEFAVPLPMDSRVKDDYERVLTSESQSIRDFLGVTSSQPDTTEYQRDSLLPKMHDILDRLSNIS
THPDLNIAEHINSESDLGREAAWAEYSSAKFLLLSYLLETASMRDIHLVIMVQGEKTQRVVERYLMGKGLLYTRP
RQEMGSGTNIEVSMVKDSLSFGIQTTRNDGVMETYKPPAAIIALDKSFSSKTPTVEHMRTTFARNGNLLPVVRLL
VSNSSEHIELCFPGLSEPERLRTVLQYSIRLRDVVGDLQDDALGVQEDAEELLSCLVSDNFNAHWSLPHIEPLHI
LSPEQLESSQQELQSRPGVDIQLTNPQAQKRAFQAEDEVEQSAKRMKTEEPTQEPTQSTESTGFPSQPLNGGLQT
LENHLVQMQNSHAAELEKLQKALAGAQARLQERENVLEKLQHRYETRTKDFHKLRREHDRLTQAKTTSDQRVEKQ
KEELMKLKDERTQLRHELEEARASLKAGGGSAAELESAREDIRRLTKDNASLERKAEYEARQAEYTREQYQTAST
VAAQSGNELRQLRSENETLKRKVEGDATHLRELNAKNDEARHLARVLELEATLTSREDLLRRKEEELREIRKNRP
STRSTSTQPRSPKWTAGNSRPTSPGINNGSSLAGRGSALRFSSEMPL*
Coding >Ani_SJS100_1|g540.t1
ATGTCGCGCAAGCGCAAGGCCTCTTCTACGATATATACAAGCCACGGAAGCCACAAACGAAAGAAACGGTGGAGA
TATCAGCACGTCGTTCATTCAAGCGACACCGAGACAGACAACGATAGTGAAGCTCTAGGTGCAGACGAGTGGCTT
ATCAACTGTATACTTGACGAGTCCGAATCGCAGTACCTGATTGACTGGGAAGGACCGTGGACGCCTACTTGGGAA
CCGAAGGAAAACGCCAACGACGTTGCCGTGCAAGTTTGGGAGGACAAGAAGCGAAGATATCAGGTCCAAGAGGAA
TTTGTTCGATACAGTCCCCAACCTCCCCTCCCTTTGTTCTACCCAGCACTGAACCAGAACCTAGTCTTGCCCAGT
CACCCGCCGCAGTCGGATATTGACAACCTACTTAACCCGGAAGTGCTTCCGACTGCCCGTGCCACTGAGGTCCCT
GCTATCTTCTCGACTCCTCGCGAACCCAGAGTATCGGACGAAGTCGAAGAGACGCCGACCACGCCTTGCCGTGCT
GGAAACACAGGCACACCGAACGTCGCTGAAGGGATCCCTGAAACTCCGCATAACGAATCTTCCGCTGCGCCGGCG
AACATACCCGAGTTATTGCCCGCCAACCCGGCCGAAGGAGCTGATGAAATACCCGAACCTCCGCCTGGCCTAGTT
GATGAACCCCAGCTATTCAGACGTGCGAGTACAGTACCCGAGTCAATTGCTGTAAACATCGGCCAATTAATAAGC
TCAATATCGAGACCCAGCATGGATACTCAAGAGAAGGAAGGACCGTCGCTGTCCGAGACCATGGAGAAATACAGC
CAATTCGAAGGGTCCACACCGAGGGAAAAGCTCAGGAATGCATATGCACAATTGCGCGCAAAAGCGAACCCTGGC
CCGGAGTCAAGTGCGACGCCATCCTCTGCTGGAGACATAGAGCCTTCGGCTCCTGTTTCTATACCTGAGACCACA
GCTCCTCTCAGTGTTCGAGTCGATAAGGAACCGACACATCCTAAAGATAATGAAGCGAACCAGGATACTACAATA
CCCCCTGTCGAGCCTGAGGAGATAGGACCTCCTCAGACGATTCAGCCGAGCGCATTGTCAATGCACTTCGCGGAA
GAGCCAACACCTGGTTCGGTCCATCTTGGGCCGTCGGAGTTTGCTGTGCCTCTTCCAATGGACTCCAGAGTTAAA
GATGACTATGAACGGGTCCTGACCAGCGAAAGCCAGAGTATTCGCGATTTTCTCGGTGTAACAAGCTCCCAACCC
GACACTACAGAATATCAGCGTGATTCGCTTTTGCCGAAGATGCATGATATACTAGATCGTTTGAGCAACATTTCT
ACACACCCAGATTTGAACATTGCGGAACACATCAACTCCGAGTCGGACCTAGGGAGGGAAGCTGCTTGGGCTGAG
TATTCAAGCGCGAAATTCTTGCTCTTAAGCTACCTCTTAGAGACAGCGAGCATGCGCGATATACATTTGGTTATT
ATGGTGCAAGGAGAGAAGACCCAGCGGGTGGTTGAACGTTATTTGATGGGCAAGGGCCTGTTGTATACCCGTCCA
CGCCAGGAAATGGGATCGGGCACGAATATCGAGGTTTCCATGGTAAAGGATTCCTTGAGTTTTGGGATTCAAACC
ACGCGCAATGATGGGGTTATGGAGACCTATAAGCCTCCTGCCGCTATCATCGCTTTAGATAAATCTTTCAGCAGC
AAGACGCCCACAGTGGAACACATGCGAACCACGTTTGCTCGCAACGGAAATCTGCTTCCGGTGGTTCGTCTTCTA
GTGTCAAACTCCAGCGAGCATATCGAGCTTTGTTTCCCCGGTCTGTCAGAGCCCGAACGTCTTAGGACAGTCTTG
CAATACTCCATACGTCTCCGTGACGTAGTTGGTGACCTTCAAGATGACGCTCTTGGAGTACAGGAGGATGCAGAG
GAACTTCTCTCCTGCCTTGTCTCGGATAACTTCAACGCTCATTGGTCTCTACCTCACATTGAGCCTTTGCACATT
CTGAGCCCCGAACAACTTGAGTCGTCTCAACAAGAGCTGCAAAGCCGACCTGGTGTCGACATTCAGCTGACGAAT
CCTCAAGCCCAGAAACGAGCATTCCAGGCAGAAGATGAGGTCGAACAATCAGCCAAGAGAATGAAAACGGAAGAG
CCGACGCAAGAGCCAACCCAGTCCACTGAATCAACTGGATTTCCTAGTCAACCATTAAACGGTGGGCTCCAAACA
CTAGAAAATCACCTTGTTCAGATGCAGAACTCGCACGCAGCAGAGCTCGAAAAGCTCCAGAAAGCTCTCGCAGGA
GCCCAAGCCCGTCTTCAGGAAAGAGAGAACGTGCTGGAAAAGCTGCAGCACCGTTACGAGACAAGAACCAAAGAC
TTCCACAAACTCCGACGGGAGCATGACCGTCTCACCCAAGCTAAGACCACATCCGACCAGCGAGTCGAAAAGCAG
AAGGAAGAGCTCATGAAATTGAAGGACGAACGGACCCAGCTCCGACACGAACTCGAAGAGGCCCGCGCATCCCTC
AAAGCAGGCGGGGGCAGCGCAGCCGAACTCGAATCAGCAAGGGAAGACATTCGGCGTCTGACTAAAGACAATGCA
TCGCTAGAACGCAAAGCCGAGTACGAAGCCCGACAAGCGGAATACACGCGCGAACAGTACCAGACCGCCTCGACA
GTGGCCGCACAATCAGGCAACGAGCTTCGCCAACTGCGCAGCGAGAACGAAACCCTGAAACGGAAGGTCGAAGGA
GACGCCACCCATCTGCGCGAACTCAACGCGAAGAACGACGAAGCCCGCCATCTCGCGCGGGTTCTCGAACTCGAA
GCAACCCTCACGTCCCGCGAAGATCTGCTCCGCCGGAAGGAAGAAGAACTTCGGGAAATTCGGAAAAATCGCCCG
TCCACTCGCTCAACCAGCACACAGCCGCGAAGCCCCAAATGGACTGCAGGTAATAGCCGGCCCACGAGTCCTGGC
ATCAACAATGGTTCATCGCTTGCAGGTCGCGGTAGTGCGCTCAGATTCAGCTCCGAAATGCCTCTTTAG
Transcript >Ani_SJS100_1|g540.t1
ATGTCGCGCAAGCGCAAGGCCTCTTCTACGATATATACAAGCCACGGAAGCCACAAACGAAAGAAACGGTGGAGA
TATCAGCACGTCGTTCATTCAAGCGACACCGAGACAGACAACGATAGTGAAGCTCTAGGTGCAGACGAGTGGCTT
ATCAACTGTATACTTGACGAGTCCGAATCGCAGTACCTGATTGACTGGGAAGGACCGTGGACGCCTACTTGGGAA
CCGAAGGAAAACGCCAACGACGTTGCCGTGCAAGTTTGGGAGGACAAGAAGCGAAGATATCAGGTCCAAGAGGAA
TTTGTTCGATACAGTCCCCAACCTCCCCTCCCTTTGTTCTACCCAGCACTGAACCAGAACCTAGTCTTGCCCAGT
CACCCGCCGCAGTCGGATATTGACAACCTACTTAACCCGGAAGTGCTTCCGACTGCCCGTGCCACTGAGGTCCCT
GCTATCTTCTCGACTCCTCGCGAACCCAGAGTATCGGACGAAGTCGAAGAGACGCCGACCACGCCTTGCCGTGCT
GGAAACACAGGCACACCGAACGTCGCTGAAGGGATCCCTGAAACTCCGCATAACGAATCTTCCGCTGCGCCGGCG
AACATACCCGAGTTATTGCCCGCCAACCCGGCCGAAGGAGCTGATGAAATACCCGAACCTCCGCCTGGCCTAGTT
GATGAACCCCAGCTATTCAGACGTGCGAGTACAGTACCCGAGTCAATTGCTGTAAACATCGGCCAATTAATAAGC
TCAATATCGAGACCCAGCATGGATACTCAAGAGAAGGAAGGACCGTCGCTGTCCGAGACCATGGAGAAATACAGC
CAATTCGAAGGGTCCACACCGAGGGAAAAGCTCAGGAATGCATATGCACAATTGCGCGCAAAAGCGAACCCTGGC
CCGGAGTCAAGTGCGACGCCATCCTCTGCTGGAGACATAGAGCCTTCGGCTCCTGTTTCTATACCTGAGACCACA
GCTCCTCTCAGTGTTCGAGTCGATAAGGAACCGACACATCCTAAAGATAATGAAGCGAACCAGGATACTACAATA
CCCCCTGTCGAGCCTGAGGAGATAGGACCTCCTCAGACGATTCAGCCGAGCGCATTGTCAATGCACTTCGCGGAA
GAGCCAACACCTGGTTCGGTCCATCTTGGGCCGTCGGAGTTTGCTGTGCCTCTTCCAATGGACTCCAGAGTTAAA
GATGACTATGAACGGGTCCTGACCAGCGAAAGCCAGAGTATTCGCGATTTTCTCGGTGTAACAAGCTCCCAACCC
GACACTACAGAATATCAGCGTGATTCGCTTTTGCCGAAGATGCATGATATACTAGATCGTTTGAGCAACATTTCT
ACACACCCAGATTTGAACATTGCGGAACACATCAACTCCGAGTCGGACCTAGGGAGGGAAGCTGCTTGGGCTGAG
TATTCAAGCGCGAAATTCTTGCTCTTAAGCTACCTCTTAGAGACAGCGAGCATGCGCGATATACATTTGGTTATT
ATGGTGCAAGGAGAGAAGACCCAGCGGGTGGTTGAACGTTATTTGATGGGCAAGGGCCTGTTGTATACCCGTCCA
CGCCAGGAAATGGGATCGGGCACGAATATCGAGGTTTCCATGGTAAAGGATTCCTTGAGTTTTGGGATTCAAACC
ACGCGCAATGATGGGGTTATGGAGACCTATAAGCCTCCTGCCGCTATCATCGCTTTAGATAAATCTTTCAGCAGC
AAGACGCCCACAGTGGAACACATGCGAACCACGTTTGCTCGCAACGGAAATCTGCTTCCGGTGGTTCGTCTTCTA
GTGTCAAACTCCAGCGAGCATATCGAGCTTTGTTTCCCCGGTCTGTCAGAGCCCGAACGTCTTAGGACAGTCTTG
CAATACTCCATACGTCTCCGTGACGTAGTTGGTGACCTTCAAGATGACGCTCTTGGAGTACAGGAGGATGCAGAG
GAACTTCTCTCCTGCCTTGTCTCGGATAACTTCAACGCTCATTGGTCTCTACCTCACATTGAGCCTTTGCACATT
CTGAGCCCCGAACAACTTGAGTCGTCTCAACAAGAGCTGCAAAGCCGACCTGGTGTCGACATTCAGCTGACGAAT
CCTCAAGCCCAGAAACGAGCATTCCAGGCAGAAGATGAGGTCGAACAATCAGCCAAGAGAATGAAAACGGAAGAG
CCGACGCAAGAGCCAACCCAGTCCACTGAATCAACTGGATTTCCTAGTCAACCATTAAACGGTGGGCTCCAAACA
CTAGAAAATCACCTTGTTCAGATGCAGAACTCGCACGCAGCAGAGCTCGAAAAGCTCCAGAAAGCTCTCGCAGGA
GCCCAAGCCCGTCTTCAGGAAAGAGAGAACGTGCTGGAAAAGCTGCAGCACCGTTACGAGACAAGAACCAAAGAC
TTCCACAAACTCCGACGGGAGCATGACCGTCTCACCCAAGCTAAGACCACATCCGACCAGCGAGTCGAAAAGCAG
AAGGAAGAGCTCATGAAATTGAAGGACGAACGGACCCAGCTCCGACACGAACTCGAAGAGGCCCGCGCATCCCTC
AAAGCAGGCGGGGGCAGCGCAGCCGAACTCGAATCAGCAAGGGAAGACATTCGGCGTCTGACTAAAGACAATGCA
TCGCTAGAACGCAAAGCCGAGTACGAAGCCCGACAAGCGGAATACACGCGCGAACAGTACCAGACCGCCTCGACA
GTGGCCGCACAATCAGGCAACGAGCTTCGCCAACTGCGCAGCGAGAACGAAACCCTGAAACGGAAGGTCGAAGGA
GACGCCACCCATCTGCGCGAACTCAACGCGAAGAACGACGAAGCCCGCCATCTCGCGCGGGTTCTCGAACTCGAA
GCAACCCTCACGTCCCGCGAAGATCTGCTCCGCCGGAAGGAAGAAGAACTTCGGGAAATTCGGAAAAATCGCCCG
TCCACTCGCTCAACCAGCACACAGCCGCGAAGCCCCAAATGGACTGCAGGTAATAGCCGGCCCACGAGTCCTGGC
ATCAACAATGGTTCATCGCTTGCAGGTCGCGGTAGTGCGCTCAGATTCAGCTCCGAAATGCCTCTTTAG
Gene >Ani_SJS100_1|g540.t1
ATGTCGCGCAAGCGCAAGGCCTCTTCTACGATATATACAAGCCACGGAAGCCACAAACGAAAGAAACGGTGGAGA
TATCAGCACGTCGTTCATTCAAGCGACACCGAGACAGACAACGATAGTGAAGCTCTAGGTGCAGACGAGTGGCTT
ATCAACTGTATACTTGACGAGTCCGAATCGCAGTACCTGATTGACTGGGAAGGACCGTGGACGCCTACTTGGGTG
AGCTTAGTGACCAGTCTGCTACCTTCTGCCCTTTCTTGCTTCATCGGAGGCTTGTTGGAAGTACTGGGAGCTTCA
TTGGTCTAACTGCCCGCCGTGAAATACCAGGAACCGAAGGAAAACGCCAACGACGTTGCCGTGCAAGTTTGGGAG
GACAAGAAGCGAAGATATCAGGTCCAAGAGGAATTTGTTCGATGTAACACTCCACTACCATTACCACCAACACCG
CCACCCGGCTCCAGTGTTCAAGAACGCTGTAGAGACTCTTTGGGTCCCAATTTCAGTCAGCCCCAGACAGAAGCC
CCGACTGACGAACCCCCGCCTAGACAGTCCCCAACCTCCCCTCCCTTTGTTCTACCCAGCACTGAACCAGAACCT
AGTCTGTGTCTGGATGACGACGCCCGCGGAATTCTGAGGAGTTCCAGTGTTAATACCGAAGTGCCCAGTCACCCG
CCGCAGTCGGATATTGACAACCTACTTAACCCGGAAGTGCTTCCGACTGCCCGTGCCACTGAGGTCCCTGCTATC
TTCTCGACTCCTCGCGAACCCAGAGTATCGGACGAAGTCGAAGAGACGCCGACCACGCCTTGCCGTGCTGGAAAC
ACAGGCACACCGAACGTCGCTGAAGGGATCCCTGAAACTCCGCATAACGAATCTTCCGCTGCGCCGGCGAACATA
CCCGAGTTATTGCCCGCCAACCCGGCCGAAGGAGCTGATGAAATACCCGAACCTCCGCCTGGCCTAGTTGATGAA
CCCCAGCTATTCAGACGTGCGAGTACAGTACCCGAGTCAATTGCTGTAAACAGTACGCACACTCCAGCAGCTCGA
ATTTCCCCGGCGCCAAGTTTTCGTTCATTAGTCGGCCAATTAATAAGCTCAATATCGAGACCCAGCATGGATACT
CAAGAGAAGGAAGGACCGTCGCTGTCCGAGACCATGGAGAAATACAGCCAATTCGAAGGGTCCACACCGAGGGAA
AAGCTCAGGAATGCATATGCACAATTGCGCGCAAAAGCGAACCCTGGCCCGGAGTCAAGTGCGACGCCATCCTCT
GCTGGAGACATAGAGCCTTCGGCTCCTGTTTCTATACCTGAGACCACAGCTCCTCTCAGTGTTCGAGTCGATAAG
GAACCGACACATCCTAAAGATAATGAAGCGAACCAGGATACTACAATACCCCCTGTCGAGCCTGAGGAGATAGGA
CCTCCTCAGACGATTCAGCCGAGCGCATTGTCAATGCACTTCGCGGAAGAGCCAACACCTGGTTCGGTCCATCTT
GGGCCGTCGGAGTTTGCTGTGCCTCTTCCAATGGACTCCAGAGTTAAAGATGACTATGAACGGGTCCTGACCAGC
GAAAGCCAGAGTATTCGCGATTTTCTCGGTGTAACAAGCTCCCAACCCGACACTACAGAATATCAGGTTCGACGC
CCACCGCCCCTCACTTTGCCGTATACTGACTAGCAAGTAGCGTGATTCGCTTTTGCCGAAGATGCATGATATACT
AGATCGTTTGAGCAACATTTCTACACACCCAGATTTGAACATTGCGGAACACATCAACTCCGAGTCGGACCTAGG
GAGGGAAGCTGCTTGGGCTGAGTATTCAAGCGCGAAATTCTTGCTCTTAAGCTACCTCTTAGAGACAGCGAGCAT
GCGCGATATACATTTGGTTATTATGGTGCAAGGAGAGAAGACCCAGCGGGTGGTTGAACGTTATTTGATGGGCAA
GGGCCTGTTGTATACCCGTCCACGCCAGGAAATGGGATCGGGCACGAATATCGAGGTTTCCATGGTAAAGGATTC
CTTGAGTTTTGGGATTCAAACCACGCGCAATGATGGGGTTATGGAGACCTATAAGCCTCCTGCCGCTATCATCGC
TTTAGATAAATCTTTCAGCAGCAAGACGCCCACAGTGGAACACATGCGAACCACGTTTGCTCGCAACGGAAATCT
GCTTCCGGTGGTTCGTCTTCTAGTGTCAAACTCCAGCGAGCATATCGAGCTTTGTTTCCCCGGTCTGTCAGAGCC
CGAACGTCTTAGGACAGTCTTGCAATACTCCATACGTCTCCGTGACGTAGTTGGTGACCTTCAAGATGACGCTCT
TGGAGTACAGGAGGATGCAGAGGAACTTCTCTCCTGCCTTGTCTCGGATAACTTCAACGCTCATTGGTCTCTACC
TCACATTGAGCCTTTGCACATTCTGAGCCCCGAACAACTTGAGTCGTCTCAACAAGAGCTGCAAAGCCGACCTGG
TGTCGACATTCAGCTGACGAATCCTCAAGCCCAGAAACGAGCATTCGTGAGTCGATCAGGATGTCAAATGTTTCT
AAAACGTCAGACTAACATCGAGGTAGCAGGCAGAAGATGAGGTCGAACAATCAGCCAAGAGAATGAAAACGGAAG
AGCCGACGCAAGAGCCAACCCAGTCCACTGAATCAACTGGATTTCCTAGTCAACCATTAAACGGTGGGCTCCAAA
CACTAGAAAATCACCTTGTTCAGATGCAGAACTCGCACGCAGCAGAGCTCGAAAAGCTCCAGAAAGCTCTCGCAG
GAGCCCAAGCCCGTCTTCAGGAAAGAGAGAACGTGCTGGAAAAGCTGCAGCACCGTTACGAGACAAGAACCAAAG
ACTTCCACAAACTCCGACGGGAGCATGACCGTCTCACCCAAGCTAAGACCACATCCGACCAGCGAGTCGAAAAGC
AGAAGGAAGAGCTCATGAAATTGAAGGACGAACGGACCCAGCTCCGACACGAACTCGAAGAGGCCCGCGCATCCC
TCAAAGCAGGCGGGGGCAGCGCAGCCGAACTCGAATCAGCAAGGGAAGACATTCGGCGTCTGACTAAAGACAATG
CATCGCTAGAACGCAAAGCCGAGTACGAAGCCCGACAAGCGGAATACACGCGCGAACAGTACCAGACCGCCTCGA
CAGTGGCCGCACAATCAGGCAACGAGCTTCGCCAACTGCGCAGCGAGAACGAAACCCTGAAACGGAAGGTCGAAG
GAGACGCCACCCATCTGCGCGAACTCAACGCGAAGAACGACGAAGCCCGCCATCTCGCGCGGGTTCTCGAACTCG
AAGCAACCCTCACGTCCCGCGAAGATCTGCTCCGCCGGAAGGAAGAAGAACTTCGGGAAATTCGGAAAAATCGCC
CGTCCACTCGCTCAACCAGCACACAGCCGCGAAGCCCCAAATGGACTGCAGGTAATAGCCGGCCCACGAGTCCTG
GCATCAACAATGGTTCATCGCTTGCAGGTCGCGGTAGTGCGCTCAGATTCAGCTCCGAAATGCCTCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail