Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5303.t1
Gene name
Locationscaffold_029:200936..205184
Strand-
Gene length (bp)4248
Transcript length (bp)4248
Coding sequence length (bp)4248
Protein length (aa) 1416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.3E-74 265 666
PF00668 Condensation Condensation domain 6.5E-26 6 236
PF00668 Condensation Condensation domain 1.0E-19 926 1411
PF00550 PP-binding Phosphopantetheine attachment site 2.3E-11 801 862
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.8E-05 674 768

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5303.t1
MAETEQYQLAYWLEQLQGSQPAQLLCDKPRSAILSGKAQVHHFALDGQLYQKLQAFCQTHQVTPFVVLLAAFRAT
HYRLTGVDDATIGTPNSRNTNLLCLRTTVEPEDSFRALIQHVQHANSAASSNQDVPFQKIVSKLRPGAADQSRHP
LVQTTFAIHSSDNANSPRFKGVTVATSNFDIEFHLIQEAQRMSGHILFSDDLFEASSIRLVESVFTEILGRGLQT
PETLVSSMPLTQGLSALADMGLADVARTDYPRDASVVELFRKQVSLSPNAVAVKNAYSSSQLTYAELDRQSDQLA
HWLVQRGLAPETMVAVLAPRSCETIMALLAILKANLAYLPLDINVPVGRLEAILSAVQGDKLVLLGAGVTPPTLQ
LKDVSFRHIAQALDEQGQLCAGALPTPTALSLAYVMFTSGSTGKPKGVQVEHRGIVRLVRETNVASKTQSSGNIA
HVANLAFDAATWEIYAALLNGGTLVCIDYMTVVDPITLGQVMQREAVRSCMLTPALLKQCLANAPWALSGLELLF
AAGDRFDPRDAAQAKGIIKGDLVNAYGPTENTTFSTIYKVPADEKCVNGMPIGVAISNSGAFVMDPEQRLVPPGV
MGELIVTGDGLARGYTDAALNKNRFVNVVINGQSVRAYRTGDRVRHRPSDGMIEFFGRMDFQVKIRGHRVELPEI
EHALLRIESVTDAVALVHQPDGGLAELASFVTVQNDIVDAAARQDSQNAGHDGQLENQAEGRLKAALQASLPKYM
IPARIVVLDKMPINANGKVDRKELARLASVFGKAAKGSRQIVEPRTEVERAVCEELSSVLNVEAVGITDNFFDLG
GHSLMAPRVAQRINQRLNTTILLRDVFAYPVVADLAKKIGELLADSSQDQLDQDLGEDEAIEIEDEEELLTMSLA
TKLRHFNSVARPQCVESLGIASEDIEEVLPATGVQTRMLVFVEEAEEMNITKPCIEHFVYHVPDDLDPIRLEQAI
LDVTKRHDAFRTVWVQVQHPLSPYAQCILNPAHPRAQLPLVHSVVHEYDPSPDSLWEQTIGNAQRSAEEYIRLDR
PGAVVQFVRSADNKHHVVIFSLFHLIYDGMSFDFLRRSFAKAYEGLPPSNLPAVGMRLPVEKHYSTDWLATSMYW
MKRLAGVAPFKAGTTVLTRATPQQYTSIRTAQDTACEMLEASISMNDLFSFTRTAKFPSPMAIVQGAWAMTLAQT
LVKAKSAGREQPSAANLDVQFGSVFHGRYSPEALRCVALMLDVLPTRIVFSDGSKKRTHREICQELFTQYVDSLE
FSEMPCPTIDFAKLTRRFDNTIILQAYPKEEVEVEVDASGLPKTSMETLPGFTREERLQEPWKETNHGYPVLMEL
WPGRDSEDEKFRLRCTYNNRWPGYEFMTQEWAQGLLLTLKQSLEQILRNPDGEFDPVGLVEAGQQ*
Coding >Ani_SJS100_1|g5303.t1
ATGGCCGAGACCGAGCAGTATCAGCTCGCGTACTGGCTGGAGCAGCTCCAGGGAAGCCAGCCCGCCCAGCTGCTC
TGCGACAAGCCCCGGTCGGCCATTCTCTCGGGCAAGGCGCAGGTCCACCACTTCGCCCTTGATGGCCAGCTTTAC
CAAAAGCTCCAGGCCTTCTGCCAGACACATCAGGTCACTCCCTTTGTGGTGCTCCTCGCCGCTTTCCGGGCGACG
CACTACCGCCTCACCGGCGTTGACGATGCCACCATTGGCACACCCAATTCAAGAAACACCAACCTCCTATGCCTT
CGCACCACCGTTGAGCCAGAGGACTCGTTCCGTGCTCTCATCCAGCACGTCCAGCACGCCAACAGTGCGGCCTCT
AGCAACCAGGATGTCCCCTTCCAGAAGATTGTCTCGAAGCTGCGTCCCGGCGCCGCCGACCAGTCCCGTCACCCA
CTCGTTCAGACGACATTTGCAATTCACTCGTCAGACAATGCCAACAGCCCACGCTTCAAAGGTGTGACGGTAGCC
ACGTCCAACTTCGACATTGAATTCCACCTCATCCAGGAGGCTCAGCGCATGAGCGGTCACATCCTCTTCTCGGAT
GATCTGTTTGAAGCTTCGTCCATCCGCTTGGTCGAGTCCGTCTTCACTGAGATCCTCGGCCGTGGCCTCCAGACA
CCCGAGACTCTCGTCTCGTCCATGCCTCTCACCCAGGGTCTCTCAGCACTGGCCGACATGGGCCTCGCAGATGTT
GCGCGCACCGATTACCCGCGCGACGCCAGCGTCGTCGAGCTCTTCCGGAAACAGGTGTCTCTCAGCCCTAACGCC
GTGGCCGTCAAGAACGCCTACTCGTCTTCTCAGCTCACGTACGCCGAGCTGGACCGGCAATCGGACCAGCTCGCC
CACTGGCTGGTCCAGCGCGGGCTCGCCCCGGAAACCATGGTCGCAGTGCTGGCGCCGCGGTCGTGCGAGACCATC
ATGGCCCTGTTGGCCATTCTCAAGGCAAATCTCGCCTATTTGCCTCTCGACATCAACGTTCCCGTTGGCCGTCTC
GAGGCTATCCTCTCCGCCGTCCAGGGAGACAAGCTCGTCCTCCTCGGTGCCGGCGTCACGCCTCCCACTCTGCAG
CTCAAGGACGTGAGCTTCCGCCACATCGCCCAGGCCCTGGACGAGCAAGGCCAGCTCTGCGCTGGCGCTCTGCCG
ACGCCCACGGCGTTGAGCCTCGCATACGTCATGTTCACGTCCGGGTCAACGGGCAAGCCCAAGGGCGTCCAAGTG
GAACACCGCGGCATCGTGCGCCTGGTGCGTGAGACTAACGTGGCCTCCAAGACGCAGTCAAGTGGCAACATTGCG
CACGTTGCCAACCTGGCCTTTGACGCCGCCACGTGGGAGATCTACGCCGCGCTGCTCAACGGCGGCACGCTCGTC
TGCATCGACTACATGACGGTCGTCGATCCCATCACTCTGGGACAGGTGATGCAGCGCGAAGCCGTGCGGTCCTGC
ATGCTCACGCCGGCCCTCCTCAAGCAGTGCCTTGCCAACGCGCCATGGGCTCTCTCCGGCCTGGAACTCCTCTTC
GCTGCCGGAGACCGCTTCGACCCCCGCGATGCGGCCCAGGCCAAGGGCATCATCAAGGGTGACCTTGTCAACGCC
TACGGTCCCACCGAGAACACCACCTTCAGCACTATCTACAAGGTCCCGGCCGACGAGAAGTGTGTCAACGGCATG
CCCATCGGCGTGGCCATCAGCAACTCGGGCGCCTTCGTCATGGACCCGGAGCAGCGCCTCGTGCCTCCTGGCGTC
ATGGGTGAGCTGATCGTCACGGGCGACGGTCTCGCCCGTGGATACACCGACGCGGCGCTCAACAAGAACCGCTTC
GTGAATGTGGTCATCAACGGCCAGTCTGTCCGCGCCTACCGCACCGGTGACCGCGTGCGCCACCGCCCTTCGGAC
GGCATGATCGAGTTCTTTGGCCGCATGGACTTCCAGGTCAAGATCCGTGGTCACCGCGTGGAGCTGCCCGAGATC
GAGCATGCTCTTCTGCGCATCGAGTCTGTCACCGATGCCGTGGCTCTGGTGCACCAACCTGACGGCGGGCTGGCG
GAGCTTGCTAGCTTTGTCACTGTTCAGAATGACATCGTGGATGCCGCTGCTCGGCAGGACTCTCAGAACGCCGGC
CACGACGGCCAACTCGAGAACCAGGCCGAGGGTCGGCTCAAGGCGGCTCTGCAGGCCTCGCTGCCCAAGTACATG
ATCCCGGCACGCATCGTCGTGCTGGACAAGATGCCCATCAACGCCAACGGCAAGGTGGACCGCAAGGAGCTGGCC
AGACTGGCGAGCGTGTTCGGCAAGGCGGCCAAGGGCTCTCGCCAGATCGTGGAGCCGCGCACCGAAGTGGAGCGT
GCCGTGTGCGAGGAGCTCTCCAGTGTGCTCAACGTCGAGGCCGTCGGCATCACCGACAACTTCTTCGACCTTGGC
GGCCACTCGCTCATGGCCCCCCGTGTTGCCCAGCGCATCAACCAGCGCCTGAATACCACTATCCTCCTGCGTGAC
GTGTTCGCCTACCCGGTGGTTGCGGACCTGGCGAAGAAGATTGGCGAGTTGCTGGCCGATTCGTCCCAGGACCAG
CTGGACCAGGACCTTGGCGAGGACGAAGCCATTGAAATCGAGGACGAGGAAGAGCTGCTGACCATGTCGCTGGCC
ACCAAGCTGCGGCACTTCAACTCGGTTGCCCGTCCGCAGTGCGTCGAGTCGCTCGGCATCGCCAGCGAAGACATC
GAGGAGGTTCTGCCCGCCACCGGGGTCCAGACCCGCATGCTCGTCTTCGTCGAGGAGGCCGAGGAGATGAACATC
ACCAAGCCCTGCATCGAGCACTTTGTCTACCACGTCCCCGACGACCTCGACCCCATCCGCCTGGAGCAGGCCATC
CTCGACGTCACCAAGCGCCACGACGCCTTCCGCACCGTCTGGGTGCAGGTCCAGCACCCCCTGAGCCCCTACGCC
CAATGCATCCTCAACCCTGCACACCCCCGTGCCCAGCTACCCCTGGTCCACAGCGTCGTGCACGAGTACGACCCC
AGCCCGGACAGCCTCTGGGAGCAGACCATCGGCAACGCGCAGCGCAGCGCCGAGGAGTACATCCGTCTGGACCGC
CCGGGCGCCGTTGTCCAGTTCGTGCGCTCCGCCGACAACAAGCACCACGTCGTCATCTTCTCCCTCTTCCACCTC
ATCTACGACGGGATGAGTTTCGACTTCCTGCGCCGCTCGTTCGCCAAGGCCTACGAGGGCCTTCCTCCCAGCAAC
CTGCCCGCGGTCGGCATGCGCCTCCCCGTCGAGAAGCACTACAGCACCGACTGGCTCGCCACCAGCATGTACTGG
ATGAAGCGTCTCGCCGGTGTGGCGCCGTTCAAGGCTGGCACGACCGTGCTCACGCGTGCCACTCCCCAACAGTAC
ACGTCCATCCGCACCGCGCAGGACACCGCGTGCGAGATGCTCGAAGCCTCCATCAGCATGAACGACCTCTTCTCC
TTCACCCGGACCGCCAAGTTCCCCTCGCCCATGGCGATAGTCCAGGGCGCCTGGGCCATGACACTCGCGCAGACA
CTGGTCAAGGCCAAGAGCGCCGGCCGGGAGCAGCCATCGGCAGCCAACCTGGACGTGCAATTTGGCAGCGTGTTC
CACGGGCGCTACAGCCCCGAGGCACTGCGCTGCGTGGCGCTGATGCTGGACGTCCTGCCCACACGTATCGTCTTC
TCGGACGGGTCCAAGAAGCGCACGCATCGCGAGATCTGCCAGGAGCTGTTCACGCAGTACGTCGACTCGCTGGAG
TTCTCGGAGATGCCGTGCCCGACCATCGACTTTGCCAAGCTGACGCGCCGGTTCGACAACACGATCATCCTGCAG
GCCTACCCCAAGGAGGAGGTCGAGGTCGAGGTCGATGCCAGCGGGCTGCCCAAGACCAGCATGGAGACGTTGCCC
GGGTTCACCCGCGAGGAGCGTCTCCAGGAGCCCTGGAAGGAGACCAACCACGGCTACCCGGTCTTGATGGAGCTC
TGGCCCGGGCGTGACAGCGAGGACGAGAAGTTCCGCCTCCGCTGCACGTACAATAACCGCTGGCCGGGCTACGAG
TTCATGACGCAGGAGTGGGCTCAGGGCTTGCTGCTGACTCTGAAGCAGTCGCTGGAACAGATCTTGCGCAATCCT
GATGGGGAGTTTGACCCGGTGGGGCTTGTCGAGGCAGGACAGCAGTAG
Transcript >Ani_SJS100_1|g5303.t1
ATGGCCGAGACCGAGCAGTATCAGCTCGCGTACTGGCTGGAGCAGCTCCAGGGAAGCCAGCCCGCCCAGCTGCTC
TGCGACAAGCCCCGGTCGGCCATTCTCTCGGGCAAGGCGCAGGTCCACCACTTCGCCCTTGATGGCCAGCTTTAC
CAAAAGCTCCAGGCCTTCTGCCAGACACATCAGGTCACTCCCTTTGTGGTGCTCCTCGCCGCTTTCCGGGCGACG
CACTACCGCCTCACCGGCGTTGACGATGCCACCATTGGCACACCCAATTCAAGAAACACCAACCTCCTATGCCTT
CGCACCACCGTTGAGCCAGAGGACTCGTTCCGTGCTCTCATCCAGCACGTCCAGCACGCCAACAGTGCGGCCTCT
AGCAACCAGGATGTCCCCTTCCAGAAGATTGTCTCGAAGCTGCGTCCCGGCGCCGCCGACCAGTCCCGTCACCCA
CTCGTTCAGACGACATTTGCAATTCACTCGTCAGACAATGCCAACAGCCCACGCTTCAAAGGTGTGACGGTAGCC
ACGTCCAACTTCGACATTGAATTCCACCTCATCCAGGAGGCTCAGCGCATGAGCGGTCACATCCTCTTCTCGGAT
GATCTGTTTGAAGCTTCGTCCATCCGCTTGGTCGAGTCCGTCTTCACTGAGATCCTCGGCCGTGGCCTCCAGACA
CCCGAGACTCTCGTCTCGTCCATGCCTCTCACCCAGGGTCTCTCAGCACTGGCCGACATGGGCCTCGCAGATGTT
GCGCGCACCGATTACCCGCGCGACGCCAGCGTCGTCGAGCTCTTCCGGAAACAGGTGTCTCTCAGCCCTAACGCC
GTGGCCGTCAAGAACGCCTACTCGTCTTCTCAGCTCACGTACGCCGAGCTGGACCGGCAATCGGACCAGCTCGCC
CACTGGCTGGTCCAGCGCGGGCTCGCCCCGGAAACCATGGTCGCAGTGCTGGCGCCGCGGTCGTGCGAGACCATC
ATGGCCCTGTTGGCCATTCTCAAGGCAAATCTCGCCTATTTGCCTCTCGACATCAACGTTCCCGTTGGCCGTCTC
GAGGCTATCCTCTCCGCCGTCCAGGGAGACAAGCTCGTCCTCCTCGGTGCCGGCGTCACGCCTCCCACTCTGCAG
CTCAAGGACGTGAGCTTCCGCCACATCGCCCAGGCCCTGGACGAGCAAGGCCAGCTCTGCGCTGGCGCTCTGCCG
ACGCCCACGGCGTTGAGCCTCGCATACGTCATGTTCACGTCCGGGTCAACGGGCAAGCCCAAGGGCGTCCAAGTG
GAACACCGCGGCATCGTGCGCCTGGTGCGTGAGACTAACGTGGCCTCCAAGACGCAGTCAAGTGGCAACATTGCG
CACGTTGCCAACCTGGCCTTTGACGCCGCCACGTGGGAGATCTACGCCGCGCTGCTCAACGGCGGCACGCTCGTC
TGCATCGACTACATGACGGTCGTCGATCCCATCACTCTGGGACAGGTGATGCAGCGCGAAGCCGTGCGGTCCTGC
ATGCTCACGCCGGCCCTCCTCAAGCAGTGCCTTGCCAACGCGCCATGGGCTCTCTCCGGCCTGGAACTCCTCTTC
GCTGCCGGAGACCGCTTCGACCCCCGCGATGCGGCCCAGGCCAAGGGCATCATCAAGGGTGACCTTGTCAACGCC
TACGGTCCCACCGAGAACACCACCTTCAGCACTATCTACAAGGTCCCGGCCGACGAGAAGTGTGTCAACGGCATG
CCCATCGGCGTGGCCATCAGCAACTCGGGCGCCTTCGTCATGGACCCGGAGCAGCGCCTCGTGCCTCCTGGCGTC
ATGGGTGAGCTGATCGTCACGGGCGACGGTCTCGCCCGTGGATACACCGACGCGGCGCTCAACAAGAACCGCTTC
GTGAATGTGGTCATCAACGGCCAGTCTGTCCGCGCCTACCGCACCGGTGACCGCGTGCGCCACCGCCCTTCGGAC
GGCATGATCGAGTTCTTTGGCCGCATGGACTTCCAGGTCAAGATCCGTGGTCACCGCGTGGAGCTGCCCGAGATC
GAGCATGCTCTTCTGCGCATCGAGTCTGTCACCGATGCCGTGGCTCTGGTGCACCAACCTGACGGCGGGCTGGCG
GAGCTTGCTAGCTTTGTCACTGTTCAGAATGACATCGTGGATGCCGCTGCTCGGCAGGACTCTCAGAACGCCGGC
CACGACGGCCAACTCGAGAACCAGGCCGAGGGTCGGCTCAAGGCGGCTCTGCAGGCCTCGCTGCCCAAGTACATG
ATCCCGGCACGCATCGTCGTGCTGGACAAGATGCCCATCAACGCCAACGGCAAGGTGGACCGCAAGGAGCTGGCC
AGACTGGCGAGCGTGTTCGGCAAGGCGGCCAAGGGCTCTCGCCAGATCGTGGAGCCGCGCACCGAAGTGGAGCGT
GCCGTGTGCGAGGAGCTCTCCAGTGTGCTCAACGTCGAGGCCGTCGGCATCACCGACAACTTCTTCGACCTTGGC
GGCCACTCGCTCATGGCCCCCCGTGTTGCCCAGCGCATCAACCAGCGCCTGAATACCACTATCCTCCTGCGTGAC
GTGTTCGCCTACCCGGTGGTTGCGGACCTGGCGAAGAAGATTGGCGAGTTGCTGGCCGATTCGTCCCAGGACCAG
CTGGACCAGGACCTTGGCGAGGACGAAGCCATTGAAATCGAGGACGAGGAAGAGCTGCTGACCATGTCGCTGGCC
ACCAAGCTGCGGCACTTCAACTCGGTTGCCCGTCCGCAGTGCGTCGAGTCGCTCGGCATCGCCAGCGAAGACATC
GAGGAGGTTCTGCCCGCCACCGGGGTCCAGACCCGCATGCTCGTCTTCGTCGAGGAGGCCGAGGAGATGAACATC
ACCAAGCCCTGCATCGAGCACTTTGTCTACCACGTCCCCGACGACCTCGACCCCATCCGCCTGGAGCAGGCCATC
CTCGACGTCACCAAGCGCCACGACGCCTTCCGCACCGTCTGGGTGCAGGTCCAGCACCCCCTGAGCCCCTACGCC
CAATGCATCCTCAACCCTGCACACCCCCGTGCCCAGCTACCCCTGGTCCACAGCGTCGTGCACGAGTACGACCCC
AGCCCGGACAGCCTCTGGGAGCAGACCATCGGCAACGCGCAGCGCAGCGCCGAGGAGTACATCCGTCTGGACCGC
CCGGGCGCCGTTGTCCAGTTCGTGCGCTCCGCCGACAACAAGCACCACGTCGTCATCTTCTCCCTCTTCCACCTC
ATCTACGACGGGATGAGTTTCGACTTCCTGCGCCGCTCGTTCGCCAAGGCCTACGAGGGCCTTCCTCCCAGCAAC
CTGCCCGCGGTCGGCATGCGCCTCCCCGTCGAGAAGCACTACAGCACCGACTGGCTCGCCACCAGCATGTACTGG
ATGAAGCGTCTCGCCGGTGTGGCGCCGTTCAAGGCTGGCACGACCGTGCTCACGCGTGCCACTCCCCAACAGTAC
ACGTCCATCCGCACCGCGCAGGACACCGCGTGCGAGATGCTCGAAGCCTCCATCAGCATGAACGACCTCTTCTCC
TTCACCCGGACCGCCAAGTTCCCCTCGCCCATGGCGATAGTCCAGGGCGCCTGGGCCATGACACTCGCGCAGACA
CTGGTCAAGGCCAAGAGCGCCGGCCGGGAGCAGCCATCGGCAGCCAACCTGGACGTGCAATTTGGCAGCGTGTTC
CACGGGCGCTACAGCCCCGAGGCACTGCGCTGCGTGGCGCTGATGCTGGACGTCCTGCCCACACGTATCGTCTTC
TCGGACGGGTCCAAGAAGCGCACGCATCGCGAGATCTGCCAGGAGCTGTTCACGCAGTACGTCGACTCGCTGGAG
TTCTCGGAGATGCCGTGCCCGACCATCGACTTTGCCAAGCTGACGCGCCGGTTCGACAACACGATCATCCTGCAG
GCCTACCCCAAGGAGGAGGTCGAGGTCGAGGTCGATGCCAGCGGGCTGCCCAAGACCAGCATGGAGACGTTGCCC
GGGTTCACCCGCGAGGAGCGTCTCCAGGAGCCCTGGAAGGAGACCAACCACGGCTACCCGGTCTTGATGGAGCTC
TGGCCCGGGCGTGACAGCGAGGACGAGAAGTTCCGCCTCCGCTGCACGTACAATAACCGCTGGCCGGGCTACGAG
TTCATGACGCAGGAGTGGGCTCAGGGCTTGCTGCTGACTCTGAAGCAGTCGCTGGAACAGATCTTGCGCAATCCT
GATGGGGAGTTTGACCCGGTGGGGCTTGTCGAGGCAGGACAGCAGTAG
Gene >Ani_SJS100_1|g5303.t1
ATGGCCGAGACCGAGCAGTATCAGCTCGCGTACTGGCTGGAGCAGCTCCAGGGAAGCCAGCCCGCCCAGCTGCTC
TGCGACAAGCCCCGGTCGGCCATTCTCTCGGGCAAGGCGCAGGTCCACCACTTCGCCCTTGATGGCCAGCTTTAC
CAAAAGCTCCAGGCCTTCTGCCAGACACATCAGGTCACTCCCTTTGTGGTGCTCCTCGCCGCTTTCCGGGCGACG
CACTACCGCCTCACCGGCGTTGACGATGCCACCATTGGCACACCCAATTCAAGAAACACCAACCTCCTATGCCTT
CGCACCACCGTTGAGCCAGAGGACTCGTTCCGTGCTCTCATCCAGCACGTCCAGCACGCCAACAGTGCGGCCTCT
AGCAACCAGGATGTCCCCTTCCAGAAGATTGTCTCGAAGCTGCGTCCCGGCGCCGCCGACCAGTCCCGTCACCCA
CTCGTTCAGACGACATTTGCAATTCACTCGTCAGACAATGCCAACAGCCCACGCTTCAAAGGTGTGACGGTAGCC
ACGTCCAACTTCGACATTGAATTCCACCTCATCCAGGAGGCTCAGCGCATGAGCGGTCACATCCTCTTCTCGGAT
GATCTGTTTGAAGCTTCGTCCATCCGCTTGGTCGAGTCCGTCTTCACTGAGATCCTCGGCCGTGGCCTCCAGACA
CCCGAGACTCTCGTCTCGTCCATGCCTCTCACCCAGGGTCTCTCAGCACTGGCCGACATGGGCCTCGCAGATGTT
GCGCGCACCGATTACCCGCGCGACGCCAGCGTCGTCGAGCTCTTCCGGAAACAGGTGTCTCTCAGCCCTAACGCC
GTGGCCGTCAAGAACGCCTACTCGTCTTCTCAGCTCACGTACGCCGAGCTGGACCGGCAATCGGACCAGCTCGCC
CACTGGCTGGTCCAGCGCGGGCTCGCCCCGGAAACCATGGTCGCAGTGCTGGCGCCGCGGTCGTGCGAGACCATC
ATGGCCCTGTTGGCCATTCTCAAGGCAAATCTCGCCTATTTGCCTCTCGACATCAACGTTCCCGTTGGCCGTCTC
GAGGCTATCCTCTCCGCCGTCCAGGGAGACAAGCTCGTCCTCCTCGGTGCCGGCGTCACGCCTCCCACTCTGCAG
CTCAAGGACGTGAGCTTCCGCCACATCGCCCAGGCCCTGGACGAGCAAGGCCAGCTCTGCGCTGGCGCTCTGCCG
ACGCCCACGGCGTTGAGCCTCGCATACGTCATGTTCACGTCCGGGTCAACGGGCAAGCCCAAGGGCGTCCAAGTG
GAACACCGCGGCATCGTGCGCCTGGTGCGTGAGACTAACGTGGCCTCCAAGACGCAGTCAAGTGGCAACATTGCG
CACGTTGCCAACCTGGCCTTTGACGCCGCCACGTGGGAGATCTACGCCGCGCTGCTCAACGGCGGCACGCTCGTC
TGCATCGACTACATGACGGTCGTCGATCCCATCACTCTGGGACAGGTGATGCAGCGCGAAGCCGTGCGGTCCTGC
ATGCTCACGCCGGCCCTCCTCAAGCAGTGCCTTGCCAACGCGCCATGGGCTCTCTCCGGCCTGGAACTCCTCTTC
GCTGCCGGAGACCGCTTCGACCCCCGCGATGCGGCCCAGGCCAAGGGCATCATCAAGGGTGACCTTGTCAACGCC
TACGGTCCCACCGAGAACACCACCTTCAGCACTATCTACAAGGTCCCGGCCGACGAGAAGTGTGTCAACGGCATG
CCCATCGGCGTGGCCATCAGCAACTCGGGCGCCTTCGTCATGGACCCGGAGCAGCGCCTCGTGCCTCCTGGCGTC
ATGGGTGAGCTGATCGTCACGGGCGACGGTCTCGCCCGTGGATACACCGACGCGGCGCTCAACAAGAACCGCTTC
GTGAATGTGGTCATCAACGGCCAGTCTGTCCGCGCCTACCGCACCGGTGACCGCGTGCGCCACCGCCCTTCGGAC
GGCATGATCGAGTTCTTTGGCCGCATGGACTTCCAGGTCAAGATCCGTGGTCACCGCGTGGAGCTGCCCGAGATC
GAGCATGCTCTTCTGCGCATCGAGTCTGTCACCGATGCCGTGGCTCTGGTGCACCAACCTGACGGCGGGCTGGCG
GAGCTTGCTAGCTTTGTCACTGTTCAGAATGACATCGTGGATGCCGCTGCTCGGCAGGACTCTCAGAACGCCGGC
CACGACGGCCAACTCGAGAACCAGGCCGAGGGTCGGCTCAAGGCGGCTCTGCAGGCCTCGCTGCCCAAGTACATG
ATCCCGGCACGCATCGTCGTGCTGGACAAGATGCCCATCAACGCCAACGGCAAGGTGGACCGCAAGGAGCTGGCC
AGACTGGCGAGCGTGTTCGGCAAGGCGGCCAAGGGCTCTCGCCAGATCGTGGAGCCGCGCACCGAAGTGGAGCGT
GCCGTGTGCGAGGAGCTCTCCAGTGTGCTCAACGTCGAGGCCGTCGGCATCACCGACAACTTCTTCGACCTTGGC
GGCCACTCGCTCATGGCCCCCCGTGTTGCCCAGCGCATCAACCAGCGCCTGAATACCACTATCCTCCTGCGTGAC
GTGTTCGCCTACCCGGTGGTTGCGGACCTGGCGAAGAAGATTGGCGAGTTGCTGGCCGATTCGTCCCAGGACCAG
CTGGACCAGGACCTTGGCGAGGACGAAGCCATTGAAATCGAGGACGAGGAAGAGCTGCTGACCATGTCGCTGGCC
ACCAAGCTGCGGCACTTCAACTCGGTTGCCCGTCCGCAGTGCGTCGAGTCGCTCGGCATCGCCAGCGAAGACATC
GAGGAGGTTCTGCCCGCCACCGGGGTCCAGACCCGCATGCTCGTCTTCGTCGAGGAGGCCGAGGAGATGAACATC
ACCAAGCCCTGCATCGAGCACTTTGTCTACCACGTCCCCGACGACCTCGACCCCATCCGCCTGGAGCAGGCCATC
CTCGACGTCACCAAGCGCCACGACGCCTTCCGCACCGTCTGGGTGCAGGTCCAGCACCCCCTGAGCCCCTACGCC
CAATGCATCCTCAACCCTGCACACCCCCGTGCCCAGCTACCCCTGGTCCACAGCGTCGTGCACGAGTACGACCCC
AGCCCGGACAGCCTCTGGGAGCAGACCATCGGCAACGCGCAGCGCAGCGCCGAGGAGTACATCCGTCTGGACCGC
CCGGGCGCCGTTGTCCAGTTCGTGCGCTCCGCCGACAACAAGCACCACGTCGTCATCTTCTCCCTCTTCCACCTC
ATCTACGACGGGATGAGTTTCGACTTCCTGCGCCGCTCGTTCGCCAAGGCCTACGAGGGCCTTCCTCCCAGCAAC
CTGCCCGCGGTCGGCATGCGCCTCCCCGTCGAGAAGCACTACAGCACCGACTGGCTCGCCACCAGCATGTACTGG
ATGAAGCGTCTCGCCGGTGTGGCGCCGTTCAAGGCTGGCACGACCGTGCTCACGCGTGCCACTCCCCAACAGTAC
ACGTCCATCCGCACCGCGCAGGACACCGCGTGCGAGATGCTCGAAGCCTCCATCAGCATGAACGACCTCTTCTCC
TTCACCCGGACCGCCAAGTTCCCCTCGCCCATGGCGATAGTCCAGGGCGCCTGGGCCATGACACTCGCGCAGACA
CTGGTCAAGGCCAAGAGCGCCGGCCGGGAGCAGCCATCGGCAGCCAACCTGGACGTGCAATTTGGCAGCGTGTTC
CACGGGCGCTACAGCCCCGAGGCACTGCGCTGCGTGGCGCTGATGCTGGACGTCCTGCCCACACGTATCGTCTTC
TCGGACGGGTCCAAGAAGCGCACGCATCGCGAGATCTGCCAGGAGCTGTTCACGCAGTACGTCGACTCGCTGGAG
TTCTCGGAGATGCCGTGCCCGACCATCGACTTTGCCAAGCTGACGCGCCGGTTCGACAACACGATCATCCTGCAG
GCCTACCCCAAGGAGGAGGTCGAGGTCGAGGTCGATGCCAGCGGGCTGCCCAAGACCAGCATGGAGACGTTGCCC
GGGTTCACCCGCGAGGAGCGTCTCCAGGAGCCCTGGAAGGAGACCAACCACGGCTACCCGGTCTTGATGGAGCTC
TGGCCCGGGCGTGACAGCGAGGACGAGAAGTTCCGCCTCCGCTGCACGTACAATAACCGCTGGCCGGGCTACGAG
TTCATGACGCAGGAGTGGGCTCAGGGCTTGCTGCTGACTCTGAAGCAGTCGCTGGAACAGATCTTGCGCAATCCT
GATGGGGAGTTTGACCCGGTGGGGCTTGTCGAGGCAGGACAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail