Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5177.t1
Gene name
Locationscaffold_028:142411..143568
Strand-
Gene length (bp)1157
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 1.2E-44 21 221
PF00734 CBM_1 Fungal cellulose binding domain 2.5E-12 305 333

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0030247 polysaccharide binding No
GO:0044238 primary metabolic process No
GO:0030246 carbohydrate binding No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5177.t1
MKYLPLVVAATASLAPTASAHYIFSKLVLNGEASADWQYIRETTRSVVYEPTKYTSTFDNLTPNDNDFRCNLGSF
SNAAKTEVAEVAAGDTIGMKLFYDTSIAHPGPGQVYMSKAPTGNVQEYEGDGEWFKIWEKTLCNENADLTKDAWC
TWGMSQFEFQIPAETPAGEYLVRAEHVGLHGAQANEAEFFYSCAQVKVTGSGTGSPSLTYKIPGLYNDNMTLFNG
LNLWVDSAEKIETDILETPIGDDVWSGHGSESSSAASPSVSSASVASPGTTTAVAHAHVQTPASSSTSSTAASSG
NLVSHWGQCGGLNYAGPTECESPCTCVEQNPWYHQCVTSS*
Coding >Ani_SJS100_1|g5177.t1
ATGAAGTATCTGCCTCTCGTCGTTGCAGCCACTGCCAGCCTGGCACCTACGGCTTCCGCCCATTATATCTTCAGC
AAGCTCGTGCTGAACGGAGAGGCTTCTGCGGATTGGCAGTACATTCGTGAGACTACTCGCAGTGTAGTCTACGAG
CCGACCAAGTACACCAGCACCTTTGACAATCTGACACCCAATGATAACGACTTCCGCTGTAACCTGGGCTCGTTC
AGCAATGCTGCCAAGACTGAGGTCGCTGAGGTCGCCGCGGGCGATACCATCGGGATGAAGCTCTTCTACGACACC
AGTATTGCGCATCCTGGTCCGGGTCAAGTTTATATGTCCAAGGCACCCACCGGCAATGTCCAGGAATACGAAGGC
GACGGGGAATGGTTCAAAATCTGGGAAAAGACTCTTTGCAACGAGAATGCCGACTTGACCAAGGACGCCTGGTGC
ACCTGGGGCATGTCTCAATTCGAGTTCCAAATCCCTGCTGAGACCCCGGCGGGCGAGTACCTGGTGCGCGCCGAG
CATGTGGGCTTGCACGGCGCTCAGGCCAACGAGGCTGAATTCTTCTACAGCTGTGCGCAAGTCAAGGTCACAGGC
TCGGGAACTGGATCTCCGAGTCTGACGTACAAAATCCCTGGTCTCTACAACGACAACATGACCCTGTTCAACGGC
CTCAATCTGTGGGTCGACTCAGCCGAGAAGATAGAGACGGATATCCTGGAGACGCCAATTGGTGATGATGTGTGG
AGTGGACATGGCTCGGAAAGCTCGTCTGCTGCCTCCCCTTCGGTCAGCAGTGCATCTGTCGCAAGCCCGGGTACA
ACTACCGCTGTTGCGCACGCCCATGTTCAGACCCCTGCCAGCAGCAGCACTTCTTCGACGGCCGCTAGCTCGGGC
AATCTTGTTTCGCACTGGGGTCAATGCGGAGGCCTCAATTATGCCGGCCCAACCGAGTGTGAGTCGCCTTGCACC
TGTGTGGAGCAGAACCCTTGGTACCATCAATGCGTGACTTCGTCTTGA
Transcript >Ani_SJS100_1|g5177.t1
ATGAAGTATCTGCCTCTCGTCGTTGCAGCCACTGCCAGCCTGGCACCTACGGCTTCCGCCCATTATATCTTCAGC
AAGCTCGTGCTGAACGGAGAGGCTTCTGCGGATTGGCAGTACATTCGTGAGACTACTCGCAGTGTAGTCTACGAG
CCGACCAAGTACACCAGCACCTTTGACAATCTGACACCCAATGATAACGACTTCCGCTGTAACCTGGGCTCGTTC
AGCAATGCTGCCAAGACTGAGGTCGCTGAGGTCGCCGCGGGCGATACCATCGGGATGAAGCTCTTCTACGACACC
AGTATTGCGCATCCTGGTCCGGGTCAAGTTTATATGTCCAAGGCACCCACCGGCAATGTCCAGGAATACGAAGGC
GACGGGGAATGGTTCAAAATCTGGGAAAAGACTCTTTGCAACGAGAATGCCGACTTGACCAAGGACGCCTGGTGC
ACCTGGGGCATGTCTCAATTCGAGTTCCAAATCCCTGCTGAGACCCCGGCGGGCGAGTACCTGGTGCGCGCCGAG
CATGTGGGCTTGCACGGCGCTCAGGCCAACGAGGCTGAATTCTTCTACAGCTGTGCGCAAGTCAAGGTCACAGGC
TCGGGAACTGGATCTCCGAGTCTGACGTACAAAATCCCTGGTCTCTACAACGACAACATGACCCTGTTCAACGGC
CTCAATCTGTGGGTCGACTCAGCCGAGAAGATAGAGACGGATATCCTGGAGACGCCAATTGGTGATGATGTGTGG
AGTGGACATGGCTCGGAAAGCTCGTCTGCTGCCTCCCCTTCGGTCAGCAGTGCATCTGTCGCAAGCCCGGGTACA
ACTACCGCTGTTGCGCACGCCCATGTTCAGACCCCTGCCAGCAGCAGCACTTCTTCGACGGCCGCTAGCTCGGGC
AATCTTGTTTCGCACTGGGGTCAATGCGGAGGCCTCAATTATGCCGGCCCAACCGAGTGTGAGTCGCCTTGCACC
TGTGTGGAGCAGAACCCTTGGTACCATCAATGCGTGACTTCGTCTTGA
Gene >Ani_SJS100_1|g5177.t1
ATGAAGTATCTGCCTCTCGTCGTTGCAGCCACTGCCAGCCTGGCACCTACGGCTTCCGCCCATTATATCTTCAGC
AAGCTCGTGCTGAACGGAGAGGCTTCTGCGGATTGGCAGTACATTCGTGAGACTACTCGCAGTGTAGTCTACGAG
CCGACCAAGTACACCAGCACCTTTGACAATCTGACACCCAATGATAACGACTTCCGCTGTAACCTGGGCTCGTTC
AGCAATGCTGCCAAGACTGAGGTCGCTGAGGTCGCCGCGGGCGATACCATCGGGATGAAGCTCTTCTACGACACC
AGTATTGCGCATCCTGGTCCGGGTCAAGTTTGTATGAGTCACCCCCTCACCCCCTGTCATGGTAACTCATCTTCT
AATCATCCTACTCTCCCGAACCGCAGATATGTCCAAGGCACCCACCGGCAATGTCCAGGAATACGAAGGCGACGG
GGAATGGTTCAAAATCTGGGAAAAGACTCTTTGCAACGAGAATGCCGACTTGACCAAGGACGCCTGGTGCACCTG
GGGCATGTCTCAATTCGAGTTCCAAATCCCTGCTGAGACCCCGGCGGGCGAGTACCTGGTGCGCGCCGAGCATGT
GGGCTTGCACGGCGCTCAGGCCAACGAGGCTGAATTCTTCTACAGGTGAGACAACCGCTCCCAGATTTATGACAT
TCAAGGAGCAACAGTATTGATACCAAGATTCTAGCTGTGCGCAAGTCAAGGTCACAGGCTCGGGAACTGGATCTC
CGAGTCTGACGTACAAAATCCCTGGTCTCTACAACGACAACATGACCCTGTTCAACGGCCTCAATCTGTGGGTCG
ACTCAGCCGAGAAGATAGAGACGGATATCCTGGAGACGCCAATTGGTGATGATGTGTGGAGTGGACATGGCTCGG
AAAGCTCGTCTGCTGCCTCCCCTTCGGTCAGCAGTGCATCTGTCGCAAGCCCGGGTACAACTACCGCTGTTGCGC
ACGCCCATGTTCAGACCCCTGCCAGCAGCAGCACTTCTTCGACGGCCGCTAGCTCGGGCAATCTTGTTTCGCACT
GGGGTCAATGCGGAGGCCTCAATTATGCCGGCCCAACCGAGTGTGAGTCGCCTTGCACCTGTGTGGAGCAGAACC
CTTGGTACCATCAATGCGTGACTTCGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail