Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5169.t1
Gene name
Locationscaffold_028:121839..123133
Strand-
Gene length (bp)1294
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 3.2E-12 117 189
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 3.7E-25 216 323

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5169.t1
MGEAPPVKEHLLIAYGRDLPQWLIDETQAKFPEAELSILQLPNFAPIPAEIARKTTLLVTFSNLPAPEDASKIKI
IHSLSSGLDHLLSHPIVKETSIPLTSSSGIHGPPIAEWTIMNWLVASRRFVYTHENQQKHNWAKNIDFMNTIHDQ
VGRKVGILGYGSIGRQIGRVASALGMQVHAYTASPRPTPSSRKDNGYIVPGTGDRDGTIPVSWHYGTDKASIHEF
LSLGLDHLVIALPLTPQTTRMLGTEEFEILSRGVSAERPRPYLTNISRGKVLDQDALIEALKGGVLGGAALDVAD
PEPLPENSPLWEAPNVQISPHVSSAGREYIPRSLDIMRENVGRLERGEELLNGFKRGKGY*
Coding >Ani_SJS100_1|g5169.t1
ATGGGCGAAGCACCCCCCGTCAAAGAGCATCTCCTCATCGCCTACGGCCGCGATCTTCCGCAATGGCTGATCGAC
GAGACGCAGGCCAAATTCCCCGAAGCCGAACTTTCCATCCTGCAGCTGCCCAATTTCGCGCCAATTCCAGCTGAA
ATCGCGCGCAAGACCACTCTCCTCGTCACCTTCAGCAACCTCCCCGCGCCGGAAGATGCATCCAAAATCAAAATC
ATCCACTCCCTCTCCTCCGGCCTCGACCACCTCCTCTCCCACCCCATCGTCAAAGAAACCTCCATCCCTCTCACC
TCCAGCTCGGGCATCCACGGCCCCCCAATTGCCGAATGGACCATCATGAACTGGCTCGTTGCCTCGCGACGCTTC
GTCTACACCCACGAAAACCAACAGAAACACAACTGGGCGAAGAACATCGACTTCATGAACACCATCCATGACCAA
GTCGGCAGGAAAGTCGGGATTCTCGGATACGGAAGTATCGGACGACAAATCGGCCGCGTCGCCTCCGCCCTAGGC
ATGCAGGTGCACGCCTACACAGCCTCGCCGCGCCCGACCCCCTCCTCCAGGAAAGACAACGGCTACATCGTCCCC
GGCACCGGCGACCGCGACGGCACGATCCCGGTATCCTGGCACTACGGGACGGACAAGGCCTCTATCCATGAATTC
CTATCTCTGGGTCTAGATCACCTCGTGATCGCGTTGCCGCTGACACCGCAGACAACCCGTATGCTTGGGACTGAG
GAATTCGAGATCCTGAGTCGTGGTGTGTCTGCGGAACGGCCACGTCCGTACCTTACGAATATCTCTCGGGGGAAG
GTCCTTGATCAGGATGCATTGATTGAAGCGCTGAAAGGGGGAGTGCTGGGTGGAGCGGCGCTGGATGTGGCGGAT
CCGGAACCCTTGCCGGAGAATAGTCCGTTGTGGGAGGCGCCGAATGTGCAGATCAGTCCGCATGTCAGTTCGGCG
GGGAGGGAATATATTCCGCGGTCGTTGGATATTATGAGGGAGAATGTGGGGAGGTTGGAGAGGGGGGAGGAATTG
TTGAATGGGTTTAAGAGAGGGAAGGGGTATTGA
Transcript >Ani_SJS100_1|g5169.t1
ATGGGCGAAGCACCCCCCGTCAAAGAGCATCTCCTCATCGCCTACGGCCGCGATCTTCCGCAATGGCTGATCGAC
GAGACGCAGGCCAAATTCCCCGAAGCCGAACTTTCCATCCTGCAGCTGCCCAATTTCGCGCCAATTCCAGCTGAA
ATCGCGCGCAAGACCACTCTCCTCGTCACCTTCAGCAACCTCCCCGCGCCGGAAGATGCATCCAAAATCAAAATC
ATCCACTCCCTCTCCTCCGGCCTCGACCACCTCCTCTCCCACCCCATCGTCAAAGAAACCTCCATCCCTCTCACC
TCCAGCTCGGGCATCCACGGCCCCCCAATTGCCGAATGGACCATCATGAACTGGCTCGTTGCCTCGCGACGCTTC
GTCTACACCCACGAAAACCAACAGAAACACAACTGGGCGAAGAACATCGACTTCATGAACACCATCCATGACCAA
GTCGGCAGGAAAGTCGGGATTCTCGGATACGGAAGTATCGGACGACAAATCGGCCGCGTCGCCTCCGCCCTAGGC
ATGCAGGTGCACGCCTACACAGCCTCGCCGCGCCCGACCCCCTCCTCCAGGAAAGACAACGGCTACATCGTCCCC
GGCACCGGCGACCGCGACGGCACGATCCCGGTATCCTGGCACTACGGGACGGACAAGGCCTCTATCCATGAATTC
CTATCTCTGGGTCTAGATCACCTCGTGATCGCGTTGCCGCTGACACCGCAGACAACCCGTATGCTTGGGACTGAG
GAATTCGAGATCCTGAGTCGTGGTGTGTCTGCGGAACGGCCACGTCCGTACCTTACGAATATCTCTCGGGGGAAG
GTCCTTGATCAGGATGCATTGATTGAAGCGCTGAAAGGGGGAGTGCTGGGTGGAGCGGCGCTGGATGTGGCGGAT
CCGGAACCCTTGCCGGAGAATAGTCCGTTGTGGGAGGCGCCGAATGTGCAGATCAGTCCGCATGTCAGTTCGGCG
GGGAGGGAATATATTCCGCGGTCGTTGGATATTATGAGGGAGAATGTGGGGAGGTTGGAGAGGGGGGAGGAATTG
TTGAATGGGTTTAAGAGAGGGAAGGGGTATTGA
Gene >Ani_SJS100_1|g5169.t1
ATGGGCGAAGCACCCCCCGTCAAAGAGCATCTCCTCATCGCCTACGGCCGCGATCTTCCGCAATGGCTGATCGAC
GAGACGCAGGCCAAATTCCCCGAAGCCGAACTTTCCATCCTGCAGCTGCCCAATTTCGCGCCAATTCCAGCTGGT
CAGTGCTTGCTTCTCGAATCCCTGCTCGCTCTGTGGCCATCATTAATCAATCAAATTCACCAGAAATCGCGCGCA
AGACCACTCTCCTCGTCACCTTCAGCAACCTCCCCGCGCCGGAAGATGCATCCAAGTAATTCCTCCCCCTGTCAC
CTCAAATTCCAGCCACAGAAATAGAACACATTTAATATAAATCCATTTAAATCTAGAATCAAAATCATCCACTCC
CTCTCCTCCGGCCTCGACCACCTCCTCTCCCACCCCATCGTCAAAGAAACCTCCATCCCTCTCACCTCCAGCTCG
GGCATCCACGGCCCCCCAATTGCCGAATGGACCATCATGAACTGGCTCGTTGCCTCGCGACGCTTCGTCTACACC
CACGAAAACCAACAGAAACACAACTGGGCGAAGAACATCGACTTCATGAACACCATCCATGACCAAGTCGGCAGG
AAAGTCGGGATTCTCGGATACGGAAGTATCGGACGACAAAGTATATCCTTCTCCCCTTACACATTCCCCTGTATC
CCCGTCTCCAAGAAAAAGCACTAACTATGGAAAAGTCGGCCGCGTCGCCTCCGCCCTAGGCATGCAGGTGCACGC
CTACACAGCCTCGCCGCGCCCGACCCCCTCCTCCAGGAAAGACAACGGCTACATCGTCCCCGGCACCGGCGACCG
CGACGGCACGATCCCGGTATCCTGGCACTACGGGACGGACAAGGCCTCTATCCATGAATTCCTATCTCTGGGTCT
AGATCACCTCGTGATCGCGTTGCCGCTGACACCGCAGACAACCCGTATGCTTGGGACTGAGGAATTCGAGATCCT
GAGTCGTGGTGTGTCTGCGGAACGGCCACGTCCGTACCTTACGAATATCTCTCGGGGGAAGGTCCTTGATCAGGA
TGCATTGATTGAAGCGCTGAAAGGGGGAGTGCTGGGTGGAGCGGCGCTGGATGTGGCGGATCCGGAACCCTTGCC
GGAGAATAGTCCGTTGTGGGAGGCGCCGAATGTGCAGATCAGTCCGCATGTCAGTTCGGCGGGGAGGGAATATAT
TCCGCGGTCGTTGGATATTATGAGGGAGAATGTGGGGAGGTTGGAGAGGGGGGAGGAATTGTTGAATGGGTTTAA
GAGAGGGAAGGGGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail