Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5060.t1
Gene name
Locationscaffold_027:168313..171148
Strand-
Gene length (bp)2835
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 3.7E-46 400 760

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0003674 molecular_function No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0101005 deubiquitinase activity No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0008233 peptidase activity No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006508 proteolysis No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0003824 catalytic activity No
GO:0008234 cysteine-type peptidase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup5353
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g5770.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g2554.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g8414.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g7786.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8033.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g3158.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g5325.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g3495.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5720.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g3059.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g4150.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g11099.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g4978.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g7219.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g5339.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g5155.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g762.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g7850.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g6759.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g5060.t1 (this protein)
Aspergillus niger CBS 147371 Ani_SJS27_1|g435.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g1669.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g10423.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g8335.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5060.t1
MPHGQPPMPTPRRQQDVPYTTAPPNMRTPPAYMGYHPHMNGHPPPAAYSPQQYPHWYPPYPAMQLPPRPYQHPYG
PMYVSAYPPSQPIMAPAHIPPASLPMQPRTSTPLQSTMSPPVGLPPLPITTQAQSPATVPVHPAPSSAVSLSPAP
APAKVSSEPKEPFRPPLPWLSVPDHPFPARIPGRRRKSRLLPTSAVSVELPTKEPHRPDQPERQTEVQRPEPVQS
PSEPQTPTLSAAPSVANSTQPTTPSSVAQNLPLRPQSQSKGAKPTIPVVPVVPVVPAPSTPRQATKDDSSRSLET
PKSVSGTAQEKANEDTQDLSQDKTEGTAKQASPAPAVPKSWADMVRSKALAKGASAPNASPAVSNGVIKPKSESL
ADVLTTLGDDVSQYSDKVAFLQPRGLVNTGNMCYMNSVLQILVSCVPFYQFLDHIGRRASHSFNSDFPMIDALIM
FMREFRIIDAAHTEEQLKLRLKPNELEDYGEAFVPEFVYEVIRQLPRFRDMRRGHQQDAQEFLGFLLEEMHEECN
RAAKDAPVTASAAPNPEAEVANEEPGDGWLEVGHKQKAAVTRSSGHIALESPITKIFGGKIRSEFRVPGNKTSVT
LEPYQPLQLDIGAPEINNIVDALKGLTKPESIQGDFNSSRGPNVTATKQIFIETMPPVLILHLKRFQYDSVTRGT
QKIWKKVGYPLDLEIPREVFPPNKRNIMMAQGGLPKYRLVGVIYHHGKNASGGHYTVDVRRQDGREWIRLDDTLI
RRVRSEDVAQAGGEEDPKVLAAALEQHKRDGPNVNIFDHIDQDDLEQSDNERGWSQVNGASGHSSKKSTSGAASA
PSSGVRTPLGRYGSRDNKVAYLLFYQRIV*
Coding >Ani_SJS100_1|g5060.t1
ATGCCCCATGGGCAGCCACCCATGCCTACTCCTCGTCGACAGCAAGATGTTCCTTACACTACAGCTCCTCCCAAC
ATGCGAACCCCTCCTGCCTACATGGGGTACCATCCCCATATGAACGGCCACCCTCCTCCGGCCGCATACTCGCCC
CAGCAATACCCTCATTGGTACCCGCCTTATCCTGCCATGCAGCTCCCTCCACGCCCATACCAACACCCTTACGGA
CCGATGTATGTGTCTGCCTATCCTCCCTCTCAGCCTATAATGGCGCCGGCCCATATTCCTCCCGCGTCTCTTCCC
ATGCAGCCGAGGACCTCCACTCCCCTACAAAGCACCATGTCTCCGCCTGTCGGACTTCCACCTCTGCCCATTACG
ACTCAGGCACAATCTCCAGCCACTGTTCCCGTGCACCCGGCGCCGAGTTCCGCTGTGTCATTGTCCCCCGCTCCT
GCACCTGCAAAGGTTTCTTCGGAGCCCAAGGAGCCTTTCCGCCCACCGCTACCTTGGCTCTCCGTCCCCGACCAC
CCTTTCCCTGCTCGGATTCCGGGCAGACGTAGGAAAAGCCGTCTTCTCCCTACGTCAGCTGTTTCCGTCGAGCTT
CCCACCAAGGAGCCTCATCGGCCTGACCAGCCTGAGAGACAAACCGAAGTCCAAAGACCGGAGCCGGTACAGTCG
CCATCGGAACCCCAAACACCAACTTTGTCTGCCGCTCCATCAGTTGCGAATTCGACACAACCCACAACTCCATCC
TCAGTTGCGCAGAACCTCCCTCTGCGTCCTCAGTCGCAGTCCAAGGGAGCCAAACCGACTATTCCTGTAGTCCCC
GTGGTCCCTGTCGTCCCGGCGCCTAGTACCCCTCGTCAAGCAACCAAGGATGATTCGAGTCGCTCGTTGGAAACA
CCCAAGTCGGTCAGTGGCACAGCCCAGGAGAAGGCAAACGAGGATACTCAGGACTTGTCCCAGGATAAGACCGAG
GGAACTGCTAAGCAGGCTTCGCCTGCCCCTGCAGTGCCTAAGTCGTGGGCGGATATGGTCCGGTCAAAAGCACTC
GCTAAAGGCGCGAGTGCTCCCAACGCATCCCCTGCTGTGTCAAATGGCGTTATCAAGCCCAAGAGTGAGTCTCTG
GCCGACGTCTTGACGACACTAGGAGACGATGTGTCGCAGTATAGCGATAAAGTTGCCTTCCTCCAACCCAGAGGA
CTCGTGAATACCGGCAACATGTGCTACATGAATTCCGTGCTTCAAATTCTCGTTTCCTGTGTGCCTTTCTACCAA
TTCTTGGATCATATTGGACGGAGGGCGTCCCACAGCTTCAACAGCGACTTTCCGATGATCGACGCTTTGATCATG
TTCATGAGAGAGTTCCGCATCATTGATGCCGCACACACTGAGGAACAGCTGAAGTTGAGGTTGAAACCAAACGAG
CTCGAGGATTACGGCGAAGCCTTTGTCCCGGAATTTGTCTACGAGGTTATTAGGCAGTTGCCACGCTTTAGGGAC
ATGCGGAGAGGCCATCAGCAAGATGCTCAAGAGTTTTTGGGCTTCCTTCTGGAAGAAATGCACGAAGAGTGCAAT
CGTGCCGCAAAAGATGCCCCTGTAACTGCCTCGGCCGCACCGAACCCCGAGGCAGAGGTTGCAAACGAAGAGCCC
GGCGATGGCTGGTTGGAGGTCGGTCACAAGCAGAAGGCGGCTGTTACGCGCTCATCTGGCCATATCGCTTTGGAA
TCGCCAATTACGAAGATCTTCGGTGGAAAGATCCGGTCAGAGTTCAGGGTGCCTGGTAACAAGACTTCTGTGACC
CTCGAGCCCTACCAGCCACTTCAGCTGGACATTGGAGCTCCTGAGATCAACAATATTGTCGATGCTCTCAAAGGA
CTCACTAAGCCGGAAAGCATTCAAGGGGACTTCAATTCTTCCCGCGGACCCAATGTCACAGCTACCAAACAGATC
TTTATTGAAACCATGCCGCCAGTTCTTATCCTTCACCTGAAGCGGTTCCAATACGACAGTGTGACCAGAGGCACC
CAAAAGATCTGGAAAAAGGTTGGATACCCGCTCGACCTGGAGATTCCTCGCGAGGTCTTCCCACCCAACAAGCGC
AATATCATGATGGCACAAGGTGGCCTGCCCAAGTATCGCCTCGTCGGCGTCATCTACCATCATGGCAAGAACGCT
AGTGGCGGCCACTACACCGTTGATGTCCGTCGTCAAGATGGACGCGAATGGATCCGCTTGGACGACACTCTTATT
CGTCGGGTTCGGAGTGAGGATGTTGCACAGGCCGGGGGCGAGGAAGACCCCAAGGTTCTTGCGGCGGCGCTCGAA
CAACACAAGCGCGACGGACCGAATGTTAACATCTTTGATCATATTGACCAGGACGACTTGGAGCAGTCCGATAAT
GAGAGAGGCTGGAGCCAGGTCAACGGCGCCAGCGGCCATTCAAGCAAGAAATCCACCTCTGGTGCAGCCTCAGCA
CCGTCTTCTGGTGTCCGCACTCCTCTTGGACGGTACGGATCCCGAGACAACAAGGTGGCTTACCTGTTATTCTAC
CAACGCATCGTTTGA
Transcript >Ani_SJS100_1|g5060.t1
ATGCCCCATGGGCAGCCACCCATGCCTACTCCTCGTCGACAGCAAGATGTTCCTTACACTACAGCTCCTCCCAAC
ATGCGAACCCCTCCTGCCTACATGGGGTACCATCCCCATATGAACGGCCACCCTCCTCCGGCCGCATACTCGCCC
CAGCAATACCCTCATTGGTACCCGCCTTATCCTGCCATGCAGCTCCCTCCACGCCCATACCAACACCCTTACGGA
CCGATGTATGTGTCTGCCTATCCTCCCTCTCAGCCTATAATGGCGCCGGCCCATATTCCTCCCGCGTCTCTTCCC
ATGCAGCCGAGGACCTCCACTCCCCTACAAAGCACCATGTCTCCGCCTGTCGGACTTCCACCTCTGCCCATTACG
ACTCAGGCACAATCTCCAGCCACTGTTCCCGTGCACCCGGCGCCGAGTTCCGCTGTGTCATTGTCCCCCGCTCCT
GCACCTGCAAAGGTTTCTTCGGAGCCCAAGGAGCCTTTCCGCCCACCGCTACCTTGGCTCTCCGTCCCCGACCAC
CCTTTCCCTGCTCGGATTCCGGGCAGACGTAGGAAAAGCCGTCTTCTCCCTACGTCAGCTGTTTCCGTCGAGCTT
CCCACCAAGGAGCCTCATCGGCCTGACCAGCCTGAGAGACAAACCGAAGTCCAAAGACCGGAGCCGGTACAGTCG
CCATCGGAACCCCAAACACCAACTTTGTCTGCCGCTCCATCAGTTGCGAATTCGACACAACCCACAACTCCATCC
TCAGTTGCGCAGAACCTCCCTCTGCGTCCTCAGTCGCAGTCCAAGGGAGCCAAACCGACTATTCCTGTAGTCCCC
GTGGTCCCTGTCGTCCCGGCGCCTAGTACCCCTCGTCAAGCAACCAAGGATGATTCGAGTCGCTCGTTGGAAACA
CCCAAGTCGGTCAGTGGCACAGCCCAGGAGAAGGCAAACGAGGATACTCAGGACTTGTCCCAGGATAAGACCGAG
GGAACTGCTAAGCAGGCTTCGCCTGCCCCTGCAGTGCCTAAGTCGTGGGCGGATATGGTCCGGTCAAAAGCACTC
GCTAAAGGCGCGAGTGCTCCCAACGCATCCCCTGCTGTGTCAAATGGCGTTATCAAGCCCAAGAGTGAGTCTCTG
GCCGACGTCTTGACGACACTAGGAGACGATGTGTCGCAGTATAGCGATAAAGTTGCCTTCCTCCAACCCAGAGGA
CTCGTGAATACCGGCAACATGTGCTACATGAATTCCGTGCTTCAAATTCTCGTTTCCTGTGTGCCTTTCTACCAA
TTCTTGGATCATATTGGACGGAGGGCGTCCCACAGCTTCAACAGCGACTTTCCGATGATCGACGCTTTGATCATG
TTCATGAGAGAGTTCCGCATCATTGATGCCGCACACACTGAGGAACAGCTGAAGTTGAGGTTGAAACCAAACGAG
CTCGAGGATTACGGCGAAGCCTTTGTCCCGGAATTTGTCTACGAGGTTATTAGGCAGTTGCCACGCTTTAGGGAC
ATGCGGAGAGGCCATCAGCAAGATGCTCAAGAGTTTTTGGGCTTCCTTCTGGAAGAAATGCACGAAGAGTGCAAT
CGTGCCGCAAAAGATGCCCCTGTAACTGCCTCGGCCGCACCGAACCCCGAGGCAGAGGTTGCAAACGAAGAGCCC
GGCGATGGCTGGTTGGAGGTCGGTCACAAGCAGAAGGCGGCTGTTACGCGCTCATCTGGCCATATCGCTTTGGAA
TCGCCAATTACGAAGATCTTCGGTGGAAAGATCCGGTCAGAGTTCAGGGTGCCTGGTAACAAGACTTCTGTGACC
CTCGAGCCCTACCAGCCACTTCAGCTGGACATTGGAGCTCCTGAGATCAACAATATTGTCGATGCTCTCAAAGGA
CTCACTAAGCCGGAAAGCATTCAAGGGGACTTCAATTCTTCCCGCGGACCCAATGTCACAGCTACCAAACAGATC
TTTATTGAAACCATGCCGCCAGTTCTTATCCTTCACCTGAAGCGGTTCCAATACGACAGTGTGACCAGAGGCACC
CAAAAGATCTGGAAAAAGGTTGGATACCCGCTCGACCTGGAGATTCCTCGCGAGGTCTTCCCACCCAACAAGCGC
AATATCATGATGGCACAAGGTGGCCTGCCCAAGTATCGCCTCGTCGGCGTCATCTACCATCATGGCAAGAACGCT
AGTGGCGGCCACTACACCGTTGATGTCCGTCGTCAAGATGGACGCGAATGGATCCGCTTGGACGACACTCTTATT
CGTCGGGTTCGGAGTGAGGATGTTGCACAGGCCGGGGGCGAGGAAGACCCCAAGGTTCTTGCGGCGGCGCTCGAA
CAACACAAGCGCGACGGACCGAATGTTAACATCTTTGATCATATTGACCAGGACGACTTGGAGCAGTCCGATAAT
GAGAGAGGCTGGAGCCAGGTCAACGGCGCCAGCGGCCATTCAAGCAAGAAATCCACCTCTGGTGCAGCCTCAGCA
CCGTCTTCTGGTGTCCGCACTCCTCTTGGACGGTACGGATCCCGAGACAACAAGGTGGCTTACCTGTTATTCTAC
CAACGCATCGTTTGA
Gene >Ani_SJS100_1|g5060.t1
ATGCCCCATGGGCAGCCACCCATGCCTACTCCTCGTCGACAGCAAGATGTTCCTTACACTACAGCTCCTCCCAAC
ATGCGAACCCCTCCTGCCTACATGGGGTACCATCCCCATATGAACGGCCACCCTCCTCCGGCCGCATACTCGCCC
CAGCAATACCCTCATTGGTACCCGCCTTATCCTGCCATGCAGCTCCCTCCACGCCCATACCAACACCCTTACGGA
CCGATGTATGTGTCTGCCTATCCTCCCTCTCAGCCTATAATGGCGCCGGCCCATATTCCTCCCGCGTCTCTTCCC
ATGCAGCCGAGGACCTCCACTCCCCTACAAAGCACCATGTCTCCGCCTGTCGGACTTCCACCTCTGCCCATTACG
ACTCAGGCACAATCTCCAGCCACTGTTCCCGTGCACCCGGCGCCGAGTTCCGCTGTGTCATTGTCCCCCGCTCCT
GCACCTGCAAAGGTTTCTTCGGAGCCCAAGGAGCCTTTCCGCCCACCGGTAAGTTGTATAGACTAGCACGCACTC
GGTTTTTTTTTCCTGACATCGGTCACAGCTACCTTGGCTCTCCGTCCCCGACCACCCTTTCCCTGCTCGGATTCC
GGGCAGACGTAGGAAAAGCCGTCTTCTCCCTACGTCAGCTGTTTCCGTCGAGCTTCCCACCAAGGAGCCTCATCG
GCCTGACCAGCCTGAGAGACAAACCGAAGTCCAAAGACCGGAGCCGGTACAGTCGCCATCGGAACCCCAAACACC
AACTTTGTCTGCCGCTCCATCAGTTGCGAATTCGACACAACCCACAACTCCATCCTCAGTTGCGCAGAACCTCCC
TCTGCGTCCTCAGTCGCAGTCCAAGGGAGCCAAACCGACTATTCCTGTAGTCCCCGTGGTCCCTGTCGTCCCGGC
GCCTAGTACCCCTCGTCAAGCAACCAAGGATGATTCGAGTCGCTCGTTGGAAACACCCAAGTCGGTCAGTGGCAC
AGCCCAGGAGAAGGCAAACGAGGATACTCAGGACTTGTCCCAGGATAAGACCGAGGGAACTGCTAAGCAGGCTTC
GCCTGCCCCTGCAGTGCCTAAGTCGTGGGCGGATATGGTCCGGTCAAAAGCACTCGCTAAAGGCGCGAGTGCTCC
CAACGCATCCCCTGCTGTGTCAAATGGCGTTATCAAGCCCAAGAGTGAGTCTCTGGCCGACGTCTTGACGACACT
AGGAGACGATGTGTCGCAGTATAGCGATAAAGTTGCCTTCCTCCAACCCAGAGGACTCGTGAATACCGGCAACAT
GTGCTACATGAATTCCGTATGTTTCTCTAAGTTGTCAGCACGAAGTGCTACTAGCTAATGACTTTACTTCAGGTG
CTTCAAATTCTCGTTTCCTGTGTGCCTTTCTACCAATTCTTGGATCATATTGGACGGAGGGCGTCCCACAGCTTC
AACAGCGACTTTCCGATGATCGACGCTTTGTGAGTTACCTGAATTTTTTGATTCTCAGTTCCTCGATGTTTTTCA
TTGTGCTTGTTTTTACTCGAAAGTCTTACTAATACGCTTGAAGGATCATGTTCATGAGAGAGTTCCGCATCATTG
ATGCCGCACACACTGAGGAACAGCTGAAGTTGAGGTTGAAACCAAACGAGCTCGAGGATTACGGCGAAGCCTTTG
TCCCGGAATTTGTCTACGAGGTTATTAGGCAGTTGCCACGCTTTAGGGACATGCGGGTGAGTCTGTTCCATCCCC
TAATCCATGAGACCATGCGCGCTAATACGTACATGATTCTAATGAATACAGAGAGGCCATCAGCAAGATGCTCAA
GAGTTTTTGGGCTTCCTTCTGGAAGAAATGCACGAAGAGTGCAATCGTGCCGCAAAAGATGCCCCTGTAACTGCC
TCGGCCGCACCGAACCCCGAGGCAGAGGTTGCAAACGAAGAGCCCGGCGATGGCTGGTTGGAGGTCGGTCACAAG
CAGAAGGCGGCTGTTACGCGCTCATCTGGCCATATCGCTTTGGAATCGCCAATTACGAAGATCTTCGGTGGAAAG
ATCCGGTCAGAGTTCAGGGTGCCTGGTAACAAGACTTCTGTGACCCTCGAGCCCTACCAGCCACTTCAGCTGGAC
ATTGGAGCTCCTGAGATCAACAATATTGTCGATGCTCTCAAAGGACTCACTAAGCCGGAAAGCATTCAAGGGGAC
TTCAATTCTTCCCGCGGACCCAATGTCACAGCTACCAAACAGATCTTTATTGAAACCATGCCGCCAGTTCTTATC
CTTCACCTGAAGCGGTTCCAATACGACAGTGTGACCAGAGGCACCCAAAAGATCTGGAAAAAGGTTGGATACCCG
CTCGACCTGGAGATTCCTCGCGAGGTCTTCCCACCCAACAAGCGCAATATCATGATGGCACAAGGTGGCCTGCCC
AAGTATCGCCTCGTCGGCGTCATCTACCATCATGGCAAGAACGCTAGTGGCGGCCACTACACCGTTGATGTCCGT
CGTCAAGATGGACGCGAATGGATCCGCTTGGACGACACTCTTATTCGTCGGGTTCGGAGTGAGGATGTTGCACAG
GCCGGGGGCGAGGAAGACCCCAAGGTTCTTGCGGCGGCGCTCGAACAACACAAGCGCGACGGACCGAATGTTAAC
ATCTTTGATCATATTGACCAGGACGACTTGGAGCAGTCCGATAATGAGAGAGGCTGGAGCCAGGTCAACGGCGCC
AGCGGCCATTCAAGCAAGAAATCCACCTCTGGTGCAGCCTCAGCACCGTCTTCTGGTGTCCGCACTCCTCTTGGA
CGGTACGGATCCCGAGACAACAAGGTGGCTTACCTGTTATTCTACCAACGCATCGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail