Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g5049.t1
Gene name
Locationscaffold_027:137266..138638
Strand-
Gene length (bp)1372
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 2.4E-17 29 309

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 81 103 22
3 172 194 22
4 204 226 22
5 258 280 22
6 290 312 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g5049.t1
MIISFLLRCHDSTWAFLHAVILNIPPSRLYIFPTLAGTVWFLTLASLLLTWLARGMPVYPGQSNPHVAFISDIAS
FELKPLFLIGASMTAVGFVFTVAAVHVMRYEPGFALVKCPVISEDTANNDQESNASYNRTSENNHRNTQNHITGH
GHDEEEEEGEEEDQETTRTLKVISLLSILAAGTASTALILLGVMDTFRYKFAHHIFLRICFGCLAIQSAGTAIVY
STEVLSFVSYLYHWGVWGNDWGRKRSTRVRIFASLSTILILIQLFLGVAFISLTIPEDVNDYRTAGILEWIIAFL
GTIYLWLFCGFFDRTTFEGYVPSILYNTAPHGKFLDRPAVAGVGVAEAEAEAESSYSAAGNTLDVDPERAPLLPQ
SQAQGGFGTRYT*
Coding >Ani_SJS100_1|g5049.t1
ATGATCATTTCGTTCCTTCTCCGCTGCCATGATTCCACCTGGGCCTTTCTCCATGCCGTTATCCTCAATATTCCT
CCATCCCGACTGTATATCTTCCCTACCTTGGCTGGTACAGTCTGGTTCCTGACTCTGGCGTCCCTGCTTCTGACA
TGGTTGGCTCGTGGAATGCCCGTCTATCCGGGTCAAAGTAATCCACATGTCGCCTTCATCTCCGACATTGCCTCC
TTCGAACTAAAACCCCTCTTCCTCATAGGTGCTTCCATGACCGCCGTGGGGTTCGTTTTCACGGTAGCTGCTGTG
CACGTCATGCGCTACGAGCCCGGTTTCGCCTTAGTTAAATGTCCAGTTATCTCCGAAGACACTGCCAACAATGAT
CAGGAATCCAATGCGTCCTACAACAGAACTAGCGAGAACAATCACCGAAATACCCAGAATCACATAACCGGACAT
GGACATGATGAGGAAGAGGAAGAAGGGGAAGAAGAAGACCAAGAAACAACCCGCACCCTCAAAGTCATATCGTTA
CTATCAATCCTCGCAGCCGGAACGGCCAGTACAGCGCTCATCCTCCTCGGAGTTATGGATACATTCCGCTACAAA
TTCGCCCATCATATCTTCCTTCGCATCTGCTTCGGATGCTTGGCGATACAGTCAGCCGGTACCGCGATTGTCTAT
TCAACTGAGGTCCTGAGTTTCGTGTCGTATTTATACCACTGGGGGGTATGGGGCAATGATTGGGGAAGAAAGAGG
AGTACACGAGTTAGGATATTTGCATCCCTCTCCACCATCCTCATCTTAATACAGCTCTTCCTCGGCGTGGCCTTC
ATCTCTCTCACCATTCCCGAAGACGTAAACGATTACAGAACAGCTGGTATCCTCGAGTGGATCATTGCATTCCTA
GGGACGATCTATCTATGGCTCTTCTGTGGGTTCTTTGATCGAACCACCTTCGAAGGCTACGTCCCCAGCATTTTA
TACAATACAGCCCCGCATGGCAAATTCCTCGACCGTCCCGCAGTAGCAGGGGTAGGAGTAGCTGAAGCTGAAGCT
GAAGCCGAGTCTTCGTACAGCGCTGCTGGTAATACCCTGGATGTGGATCCTGAGCGGGCGCCGTTGCTTCCTCAG
TCTCAAGCTCAGGGTGGGTTTGGGACGAGGTATACGTAG
Transcript >Ani_SJS100_1|g5049.t1
ATGATCATTTCGTTCCTTCTCCGCTGCCATGATTCCACCTGGGCCTTTCTCCATGCCGTTATCCTCAATATTCCT
CCATCCCGACTGTATATCTTCCCTACCTTGGCTGGTACAGTCTGGTTCCTGACTCTGGCGTCCCTGCTTCTGACA
TGGTTGGCTCGTGGAATGCCCGTCTATCCGGGTCAAAGTAATCCACATGTCGCCTTCATCTCCGACATTGCCTCC
TTCGAACTAAAACCCCTCTTCCTCATAGGTGCTTCCATGACCGCCGTGGGGTTCGTTTTCACGGTAGCTGCTGTG
CACGTCATGCGCTACGAGCCCGGTTTCGCCTTAGTTAAATGTCCAGTTATCTCCGAAGACACTGCCAACAATGAT
CAGGAATCCAATGCGTCCTACAACAGAACTAGCGAGAACAATCACCGAAATACCCAGAATCACATAACCGGACAT
GGACATGATGAGGAAGAGGAAGAAGGGGAAGAAGAAGACCAAGAAACAACCCGCACCCTCAAAGTCATATCGTTA
CTATCAATCCTCGCAGCCGGAACGGCCAGTACAGCGCTCATCCTCCTCGGAGTTATGGATACATTCCGCTACAAA
TTCGCCCATCATATCTTCCTTCGCATCTGCTTCGGATGCTTGGCGATACAGTCAGCCGGTACCGCGATTGTCTAT
TCAACTGAGGTCCTGAGTTTCGTGTCGTATTTATACCACTGGGGGGTATGGGGCAATGATTGGGGAAGAAAGAGG
AGTACACGAGTTAGGATATTTGCATCCCTCTCCACCATCCTCATCTTAATACAGCTCTTCCTCGGCGTGGCCTTC
ATCTCTCTCACCATTCCCGAAGACGTAAACGATTACAGAACAGCTGGTATCCTCGAGTGGATCATTGCATTCCTA
GGGACGATCTATCTATGGCTCTTCTGTGGGTTCTTTGATCGAACCACCTTCGAAGGCTACGTCCCCAGCATTTTA
TACAATACAGCCCCGCATGGCAAATTCCTCGACCGTCCCGCAGTAGCAGGGGTAGGAGTAGCTGAAGCTGAAGCT
GAAGCCGAGTCTTCGTACAGCGCTGCTGGTAATACCCTGGATGTGGATCCTGAGCGGGCGCCGTTGCTTCCTCAG
TCTCAAGCTCAGGGTGGGTTTGGGACGAGGTATACGTAG
Gene >Ani_SJS100_1|g5049.t1
ATGATCATTTCGTTCCTTCTCCGCTGCCATGATTCCACCTGGGCCTTTCTCCATGCCGTTATCCTCAATATTCCT
CCATCCCGACTGTATATCTTCCCTACCTTGGCTGGTACAGTCTGGTTCCTGACTCTGGCGTCCCTGCTTCTGACA
TGGTTGGCTCGTGGAATGCCCGTCTATCCGGGTCAAAGTAATCCACATGTCGCGTGGGTGTTTCTTCCATCTCAA
TTACACATTACAGTTTAGATGGTTATTGATCTCGAGGATAGCTTCATCTCCGACATTGCCTCCTTCGAACTAAAA
CCCCTCTTCCTCATAGGTGCTTCCATGACCGCCGTGGGGTTCGTTTTCACGGTAGCTGCTGTGCACGTCATGCGC
TACGAGCCCGGTTTCGCCTTAGTTAAATGTCCAGTTATCTCCGAAGACACTGCCAACAATGATCAGGAATCCAAT
GCGTCCTACAACAGAACTAGCGAGAACAATCACCGAAATACCCAGAATCACATAACCGGACATGGACATGATGAG
GAAGAGGAAGAAGGGGAAGAAGAAGACCAAGAAACAACCCGCACCCTCAAAGTCATATCGTTACTATCAATCCTC
GCAGCCGGAACGGCCAGTACAGCGCTCATCCTCCTCGGAGTTATGGATACATTCCGCTACAAATTCGCCCATCAT
ATCTTCCTTCGCATCTGCTTCGGATGCTTGGCGATACAGTCAGCCGGTACCGCGATTGTCTATTCAACTGAGGTC
CTGAGTTTCGTGTCGTATTTATACCACTGGGGGGTATGGGGCAATGATTGGGGAAGAAAGAGGAGTACACGAGTT
AGGATATTGTATGTGCACCTTCCCTCTATTAAATCACCTTACAACCTTCTAAACATTGTTGGAAAACGGACAGTG
CATCCCTCTCCACCATCCTCATCTTAATACAGCTCTTCCTCGGCGTGGCCTTCATCTCTCTCACCATTCCCGAAG
ACGTAAACGATTACAGAACAGCTGGTATCCTCGAGTGGATCATTGCATTCCTAGGGACGATCTATCTATGGCTCT
TCTGTGGGTTCTTTGATCGGTACGCTCACGCCTCCTTGCACAAGTCTATGAGCATCTTATCATCATTCCTTCATT
GTGATGATTGCTGACCGCAGGCAGAACCACCTTCGAAGGCTACGTCCCCAGCATTTTATACAATACAGCCCCGCA
TGGCAAATTCCTCGACCGTCCCGCAGTAGCAGGGGTAGGAGTAGCTGAAGCTGAAGCTGAAGCCGAGTCTTCGTA
CAGCGCTGCTGGTAATACCCTGGATGTGGATCCTGAGCGGGCGCCGTTGCTTCCTCAGTCTCAAGCTCAGGGTGG
GTTTGGGACGAGGTATACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail