Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4929.t1
Gene name
Locationscaffold_026:192855..194070
Strand-
Gene length (bp)1215
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 1.1E-32 51 122
PF01020 Ribosomal_L40e Ribosomal L40e family 2.3E-30 126 175
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 2.2E-15 49 119

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005515 protein binding Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0043226 organelle No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No
GO:1901564 organonitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0009059 macromolecule biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup10975
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g7097.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g7397.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6211.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g2620.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g6024.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g6042.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g2366.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g2818.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g1500.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g6079.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g5935.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g4929.t1 (this protein)
Aspergillus niger CBS 147371 Ani_SJS27_1|g7779.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3409.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4929.t1
MKAQSQHGPRTTDHGPRTASNREIVKLTSPHPTDLSADRQPATTKTAAMQIFVKTLTGKTITLDVESSDTIDNVK
TKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYAR
LPPRATNCRKKKCGHTNQLRPKKKLK*
Coding >Ani_SJS100_1|g4929.t1
ATGAAAGCACAATCACAACACGGACCGCGGACCACGGACCACGGACCACGGACAGCCTCCAACCGAGAAATCGTG
AAATTGACATCGCCTCATCCGACCGACCTTTCAGCCGATCGTCAGCCAGCAACAACGAAAACCGCAGCCATGCAG
ATTTTCGTCAAGACCCTCACGGGTAAGACCATTACCCTCGACGTCGAGTCGAGCGACACCATCGACAACGTCAAG
ACCAAGATCCAGGACAAGGAGGGTATCCCCCCGGATCAGCAGCGTCTTATCTTCGCTGGTAAGCAGCTTGAGGAT
GGCCGCACCCTGAGCGACTACAACATCCAGAAGGAGTCCACCCTCCACCTGGTCCTCCGTCTCCGTGGTGGTATC
ATCGAGCCCTCCCTTAAGGCTCTCGCCTCCAAGTACAACTGCGAGAAGTCCATCTGCCGCAAGTGCTACGCCCGT
CTTCCCCCCCGTGCCACCAACTGCCGCAAGAAGAAGTGTGGTCACACCAACCAGCTCCGCCCCAAGAAGAAGCTC
AAATAG
Transcript >Ani_SJS100_1|g4929.t1
ATGAAAGCACAATCACAACACGGACCGCGGACCACGGACCACGGACCACGGACAGCCTCCAACCGAGAAATCGTG
AAATTGACATCGCCTCATCCGACCGACCTTTCAGCCGATCGTCAGCCAGCAACAACGAAAACCGCAGCCATGCAG
ATTTTCGTCAAGACCCTCACGGGTAAGACCATTACCCTCGACGTCGAGTCGAGCGACACCATCGACAACGTCAAG
ACCAAGATCCAGGACAAGGAGGGTATCCCCCCGGATCAGCAGCGTCTTATCTTCGCTGGTAAGCAGCTTGAGGAT
GGCCGCACCCTGAGCGACTACAACATCCAGAAGGAGTCCACCCTCCACCTGGTCCTCCGTCTCCGTGGTGGTATC
ATCGAGCCCTCCCTTAAGGCTCTCGCCTCCAAGTACAACTGCGAGAAGTCCATCTGCCGCAAGTGCTACGCCCGT
CTTCCCCCCCGTGCCACCAACTGCCGCAAGAAGAAGTGTGGTCACACCAACCAGCTCCGCCCCAAGAAGAAGCTC
AAATAG
Gene >Ani_SJS100_1|g4929.t1
ATGAAAGCACAATCACAACACGGACCGCGGACCACGGACCACGGACCACGGACAGCCTCCAACGTATGCATGATG
CTAAATGGATGATGTAAAAGTAGTTAGGCTACGGGCTATGGAGACTGCGGAGAGGCCCCGAACGCGGCCGGACTG
CCCTAAACCCTGATCACGTGCGGTCCGTTCCACCTTTGCTAAGCGAGAAATCGTGAAATTGACATCGCCTCATCC
GACCGACCTTTCAGCCGATCGTCAGCCAGCAACAACGAAAACCGCAGCCAGTACGTATACCCTCTTCATTCGTGA
ATGCGAAATGCGTGTTCCCTGAAGTCGCAAACTAACATGTCGTTTTTTCCGCGTCTCTGCAGTGCAGATGTAGGT
CATTCCAAGTCCCCTGGCAACCACCCGTCGAATTACGGTCGAATCCCGAAAGATGGCACGAATATATCATCGAAA
ATGAAATAAGGAAACTGACCCAGGCTCTTCTCCGATTAATAGTTTCGTCAAGACCCTCACGGGTAAGACCATTAC
CCTCGACGTCGAGTCGAGCGACACCATCGACAACGTCAAGACCAAGATCCAGGACAAGGAGGGTATCCCCCCGGA
TCAGCAGCGTCTTATCTTCGCTGGTAAGCAGCTTGAGGATGGCCGCACCCTGAGCGACTACAACATCCAGAAGGT
ATGAGTGAAACGGTTCCGCGAATCATCTATACGTCGATTTCGTCTGCTCGGATAGTCGGTTACGAACATGATGCG
ATACGGGTCGGTTGGGGCGCCACAACATACTACTTGGGTTTGAGGGGAGGATCAATCGGCACGGTCGCATTCATG
AACGTTTCACGACTATCGACATTCGATGCGACTTGACTATTGGGGATATAGTTTGACTGACGGGTTCTTTTTCTC
GACTATAGGAGTCCACCCTCCACCTGGTCCTCCGTCTCCGTGGTGGTATCATCGAGCCCTCCCTTAAGGCTCTCG
CCTCCAAGTACAACTGCGAGAAGTCCATCTGCCGCAAGTGCTACGTACGTCCATCCATCTATTCTACTTTTCTAT
TCTTCCGACTCGATCCCGCCCTCTTTTGAGTCCCGCCTAGCGAACCATTTCCCCCACTAACATTGATCCTCCGAT
TAGGCCCGTCTTCCCCCCCGTGCCACCAACTGCCGCAAGAAGAAGTGTGGTCACACCAACCAGCTCCGCCCCAAG
AAGAAGCTCAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail