Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4828.t1
Gene name
Locationscaffold_025:276475..278091
Strand+
Gene length (bp)1616
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 2.2E-46 97 294
PF03936 Terpene_synth_C Terpene synthase family, metal binding domain 1.3E-06 165 292

GO

GO Term Description Terminal node
GO:0010333 terpene synthase activity Yes
GO:0016829 lyase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0005488 binding No
GO:0016835 carbon-oxygen lyase activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4828.t1
MAVTRVQQSISSPTVKIPRQDTSLTIRLPEMFVLFLSGEPIVNRHYKSVKELSEAWISRECYFDERGRRRLQKTD
FAYFCSIAAPDAEPEELRTVIDWGNWVFPFDDLFDNGSLKDDPERAQILVEDLRAGMADEAGQRPVLSDYPIVQV
HNSVWHRITQAQPIGIRRRFARAMNDYCTGCLAQVRSCSKGELPSLEEMLCLRRQSAGVSPLFALVEYAHKLDIP
DHVFECKSIQEIERIGTDLVLLQNDILSYCKEEKEGVSHNLVAICRHNGMPAQVAFNHVGEMLIERYRDWYLALA
ALPTWGERVDADVQEYIRGVQNVVRANLHWSFRSGRYFGKANDQVRKTGMVTVRGNNADFKLSMA*
Coding >Ani_SJS100_1|g4828.t1
ATGGCCGTCACAAGAGTCCAGCAGAGTATATCTTCGCCAACAGTCAAGATACCCCGGCAAGATACTTCTCTCACC
ATCCGCCTCCCTGAAATGTTCGTGTTGTTCTTGTCGGGCGAACCTATAGTAAATCGGCACTATAAGTCTGTGAAA
GAGCTGTCAGAAGCATGGATCTCTAGGGAATGCTACTTTGATGAAAGAGGCCGAAGGCGACTACAAAAGACGGAC
TTCGCTTATTTCTGTTCCATCGCAGCTCCAGATGCTGAGCCCGAAGAGTTGCGGACAGTTATTGACTGGGGAAAC
TGGGTGTTCCCTTTTGATGACCTCTTCGATAATGGAAGCCTCAAGGACGACCCAGAACGTGCCCAAATACTTGTT
GAGGATTTGCGAGCAGGCATGGCCGACGAAGCTGGGCAGAGGCCAGTACTCTCAGATTACCCAATAGTACAGGTG
CACAACTCAGTATGGCACCGAATCACTCAGGCTCAACCTATCGGGATTCGTCGCAGGTTTGCACGTGCCATGAAT
GACTACTGCACCGGATGCTTGGCTCAAGTACGCTCATGCTCCAAGGGAGAGTTGCCCTCGCTTGAAGAAATGCTC
TGTCTGCGTAGGCAGTCTGCAGGTGTTTCGCCGCTCTTTGCCTTAGTAGAATATGCCCACAAACTAGATATCCCA
GATCATGTGTTTGAATGCAAGAGCATCCAAGAGATCGAGAGGATTGGTACTGACCTCGTGTTACTGCAAAACGAC
ATACTATCATACTGCAAAGAAGAGAAAGAAGGTGTGAGCCATAACTTAGTGGCCATCTGCCGTCACAATGGCATG
CCAGCGCAGGTAGCGTTTAATCATGTCGGCGAAATGCTCATTGAGCGCTACCGAGACTGGTACCTTGCTTTGGCA
GCACTGCCAACCTGGGGGGAACGGGTCGATGCAGATGTTCAAGAATACATCCGAGGCGTGCAGAATGTCGTTCGC
GCTAATCTTCACTGGAGCTTCCGGTCCGGGCGATACTTTGGGAAAGCAAACGACCAAGTGCGGAAGACCGGAATG
GTGACTGTGCGGGGCAACAACGCCGACTTCAAGCTGTCTATGGCGTAG
Transcript >Ani_SJS100_1|g4828.t1
ATGGCCGTCACAAGAGTCCAGCAGAGTATATCTTCGCCAACAGTCAAGATACCCCGGCAAGATACTTCTCTCACC
ATCCGCCTCCCTGAAATGTTCGTGTTGTTCTTGTCGGGCGAACCTATAGTAAATCGGCACTATAAGTCTGTGAAA
GAGCTGTCAGAAGCATGGATCTCTAGGGAATGCTACTTTGATGAAAGAGGCCGAAGGCGACTACAAAAGACGGAC
TTCGCTTATTTCTGTTCCATCGCAGCTCCAGATGCTGAGCCCGAAGAGTTGCGGACAGTTATTGACTGGGGAAAC
TGGGTGTTCCCTTTTGATGACCTCTTCGATAATGGAAGCCTCAAGGACGACCCAGAACGTGCCCAAATACTTGTT
GAGGATTTGCGAGCAGGCATGGCCGACGAAGCTGGGCAGAGGCCAGTACTCTCAGATTACCCAATAGTACAGGTG
CACAACTCAGTATGGCACCGAATCACTCAGGCTCAACCTATCGGGATTCGTCGCAGGTTTGCACGTGCCATGAAT
GACTACTGCACCGGATGCTTGGCTCAAGTACGCTCATGCTCCAAGGGAGAGTTGCCCTCGCTTGAAGAAATGCTC
TGTCTGCGTAGGCAGTCTGCAGGTGTTTCGCCGCTCTTTGCCTTAGTAGAATATGCCCACAAACTAGATATCCCA
GATCATGTGTTTGAATGCAAGAGCATCCAAGAGATCGAGAGGATTGGTACTGACCTCGTGTTACTGCAAAACGAC
ATACTATCATACTGCAAAGAAGAGAAAGAAGGTGTGAGCCATAACTTAGTGGCCATCTGCCGTCACAATGGCATG
CCAGCGCAGGTAGCGTTTAATCATGTCGGCGAAATGCTCATTGAGCGCTACCGAGACTGGTACCTTGCTTTGGCA
GCACTGCCAACCTGGGGGGAACGGGTCGATGCAGATGTTCAAGAATACATCCGAGGCGTGCAGAATGTCGTTCGC
GCTAATCTTCACTGGAGCTTCCGGTCCGGGCGATACTTTGGGAAAGCAAACGACCAAGTGCGGAAGACCGGAATG
GTGACTGTGCGGGGCAACAACGCCGACTTCAAGCTGTCTATGGCGTAG
Gene >Ani_SJS100_1|g4828.t1
ATGGCCGTCACAAGAGTCCAGCAGAGTATATCTTCGCCAACAGTCAAGATACCCCGGCAAGATACTTCTCTCACC
ATCCGCCTCCCTGAAATGTTCGTGTTGTTCTTGTCGGGCGAACCTATAGTAAATCGGCACTATAAGTCTGTGAAA
GAGCTGTCAGAAGCATGGATCTCTAGGTGCATATCGCCCCCTAATGTGGGCATCACCTTTCTCTAACCTAGCCAC
CGCCATGACAGGGAATGCTACTTTGATGAAAGAGGCCGAAGGCGACTACAAAAGACGGACTTCGCTTATTTCTGT
TCCATCGCAGCTCCAGATGCTGAGCCCGAAGAGTTGCGGACAGTTATTGACTGGGGAAACTGGGTGCGTTTCATA
ACCACGACCGACCGCATAAAGTTCCACTGACTAGATCTAACCATTATTTCCCAAGCAGGTGTTCCCTTTTGATGA
CCGTAAGCACCATCTCTCTTGGAAGGCTTCTGTGTGATGACTGAGCTTCGATTCTAGTCTTCGATAATGGAAGCC
TCAAGGACGACCCAGAACGTGCCCAAATACTTGTTGAGGATTTGCGAGCAGGCATGGCCGACGAAGCTGGGCAGA
GGCCAGTACTCTCAGATTACCCAATAGTACAGGTGCACAACTCAGTATGGCACCGAATCACTCAGGTACGTTGAT
CATTATACTGTACTGGGAGTGCATATTGACGTCTGACGGTATTGCAGGCTCAACCTATCGGTATGTAGCGCTGGG
ATTCCTCTACACACTTTAGGGTATCTGCTAACGTCGTTTAAGGGATTCGTCGCAGGTTTGCACGTGCCATGAATG
ACTACTGCACCGGATGCTTGGCTCAAGTACGCTCATGCTCCAAGGGAGAGTTGCCCTCGCTTGAAGAAATGCTCT
GTCTGCGTAGGCAGTCTGCAGGTGTTTCGCCGCTCTTTGCCTTAGTAGAGTATGTTATGACGTCTGCTTGCCTGT
GAATGACACTAACTTGAGGGATATTGCAGATATGCCCACAAACTAGATATCCCAGATCATGTGTTTGAATGCAAG
AGCATCCAAGAGATCGAGAGGATTGGTACTGACCTCGTGTTACTGTAGGCTGCCCCAACACATCACCCAACATCT
GAATTCACTAACGTATCCTAGGCAAAACGACATACTATCATACTGCAAAGAAGAGGTTAGTTGTCTACATTGAAA
TACCAGCTCTGACCCGCATGACTTACAAAAGAATACAGAAAGAAGGTGTGAGCCATAACTTAGTGGCCATCTGCC
GTCACAATGGCATGCCAGCGCAGGTAGCGTTTAATCATGTCGGCGAAATGCTCATTGAGCGCTACCGAGACTGGT
ACCTTGCTTTGGCAGCACTGCCAACCTGGGGGGAACGGGTCGATGCAGATGTTCAAGAATACATCCGAGGCGTGC
AGAATGTCGTTCGCGCTAATCTTCACTGGAGGTAGGTGTTGACTAGCGATCTTTGTTACCCAAAATACTCACGAT
GATGCCATAGCTTCCGGTCCGGGCGATACTTTGGGAAAGCAAACGACCAAGTGCGGAAGACCGGAATGGTGACTG
TGCGGGGCAACAACGCCGACTTCAAGCTGTCTATGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail