Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4808.t1
Gene name
Locationscaffold_025:220150..222208
Strand+
Gene length (bp)2058
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20143 NAD_kinase_C ATP-NAD kinase C-terminal domain 9.9E-38 438 563
PF01513 NAD_kinase ATP-NAD kinase N-terminal domain 6.1E-27 283 415

GO

GO Term Description Terminal node
GO:0003951 NAD+ kinase activity Yes
GO:0006741 NADP biosynthetic process Yes
GO:0019438 aromatic compound biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0016740 transferase activity No
GO:0006793 phosphorus metabolic process No
GO:0044238 primary metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006739 NADP metabolic process No
GO:0046496 nicotinamide nucleotide metabolic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019362 pyridine nucleotide metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006753 nucleoside phosphate metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016301 kinase activity No
GO:0009165 nucleotide biosynthetic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0019363 pyridine nucleotide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0019359 nicotinamide nucleotide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4808.t1
MASSPLDHGSMNPSSASSSDPLPATGPLPSPSISLPSSPPPPPSSAAPPLSDPPVRPPPPYRSATVGASLLRDYA
LHIDPSHTTNDIHAADSAPESPNLGLGSLQKPDLPREGAAGPSFTSSFLPRRQTASLAGHHRNALSNDSIPRQTL
LKALASRPSMCNHQSPNMPLAASLGLLNTNPTSSEETERNSSNSSSQMLSAALSNIQLGTYLDRSPATARLVMQS
PCFFHQRFDDAVNIQKVLEEIADDEWLSHSRLVQTATGVREVSKQLQRRPIKRAVKNVMIVTKARDNSLVHLTRE
LAEWLLSTPRYGNDLGVNVYVDAKLRNSRRFDAPGLLEKEPRFKEMLHYWTPDLCWTAPEKFDLVLTLGGDGTVL
FTSWLFQRIVPPVLCFSLGSLGFLTNFEFENYKSHLNAVMGDVDRSKGAEAGAVEEGEQFEVLNELVIDRGPSPY
VSNLELYADNDLLTVVQADGCIFSTPTGSTAYSLSAGGSLIHPSIPGILLTPICPHTLSFRPMVLSDTLLLRIAV
PAGSRSTAYCSFDGKGRVELRQGDYVTVEASQYPFPTVVAGSGEWFQSVQRALRWNTRGAVQKSWHSSSDAGLEA
TEDDEDTEWDIDTDAGLTGTDSGLGVSEDGDAGSISPLKRQMSMFST*
Coding >Ani_SJS100_1|g4808.t1
ATGGCGTCCTCCCCACTTGACCATGGCTCGATGAACCCTTCTTCTGCCTCGTCCTCCGATCCGCTGCCCGCGACC
GGCCCTCTGCCGTCGCCCTCAATATCTTTGCCCTCATCACCACCACCACCGCCGTCCTCCGCGGCCCCACCACTA
TCAGATCCTCCGGTGCGCCCTCCTCCTCCTTATCGCTCGGCCACTGTGGGAGCATCGCTCCTCCGCGACTATGCC
TTGCACATAGATCCTTCTCACACGACAAACGATATCCACGCAGCCGACTCGGCTCCCGAGTCTCCCAATCTGGGT
CTCGGCTCACTTCAGAAACCTGATCTTCCTCGTGAGGGTGCCGCTGGTCCCTCTTTCACCTCGTCCTTCCTGCCA
CGCCGGCAGACGGCCTCTCTAGCGGGCCATCATCGGAACGCGTTGTCTAACGATTCAATTCCTCGCCAAACCCTT
CTCAAAGCTCTCGCATCACGACCATCCATGTGCAACCACCAAAGCCCAAACATGCCGCTGGCGGCCTCTTTGGGG
CTTCTCAACACGAACCCTACCTCCTCGGAAGAAACGGAGCGCAACTCCAGCAATTCCTCGTCACAGATGCTCTCT
GCAGCTCTGTCCAATATTCAGCTAGGGACCTACCTGGACCGTTCTCCCGCGACAGCCCGGTTGGTTATGCAGTCA
CCATGCTTCTTCCACCAGCGTTTCGATGACGCCGTAAATATTCAGAAGGTATTGGAAGAGATTGCGGACGACGAG
TGGCTATCGCATTCCCGCCTGGTACAGACAGCGACTGGTGTCCGAGAGGTGTCGAAGCAATTGCAGCGTAGGCCA
ATCAAACGCGCTGTCAAGAATGTTATGATCGTCACCAAAGCACGCGATAATAGCCTGGTGCATCTGACCCGCGAA
TTGGCGGAATGGCTCCTCTCCACCCCTCGCTACGGCAACGATTTGGGTGTGAACGTCTACGTAGACGCTAAACTT
CGGAACTCACGAAGATTCGATGCACCGGGGCTCCTGGAGAAGGAACCCCGGTTCAAGGAGATGCTGCACTACTGG
ACCCCCGATCTCTGCTGGACAGCTCCCGAGAAATTCGATTTGGTCCTCACATTAGGAGGGGATGGGACCGTGCTT
TTCACATCCTGGCTCTTCCAGCGCATCGTCCCCCCGGTCCTCTGCTTTTCTCTGGGAAGCCTAGGGTTCCTGACG
AATTTCGAGTTTGAGAATTACAAGTCTCACCTGAATGCGGTCATGGGTGATGTAGACCGCAGCAAGGGCGCCGAG
GCGGGCGCCGTGGAGGAAGGGGAGCAGTTTGAGGTGTTGAACGAGCTCGTGATTGATCGAGGGCCGTCACCATAC
GTGTCAAACCTTGAACTGTACGCAGATAATGATCTGCTCACCGTGGTGCAAGCGGACGGGTGCATTTTCTCTACT
CCTACCGGTTCCACGGCATACTCTCTTTCCGCTGGCGGTTCCTTGATTCACCCCTCTATTCCCGGCATTCTTCTT
ACCCCCATTTGTCCCCATACACTTTCTTTCCGTCCCATGGTTCTCTCCGATACCCTGCTACTTCGTATTGCCGTT
CCCGCCGGGTCGCGGTCGACCGCGTACTGCTCGTTCGATGGCAAGGGTCGTGTGGAACTTCGCCAAGGCGACTAT
GTTACCGTCGAAGCAAGTCAATACCCCTTCCCGACCGTCGTGGCGGGTAGTGGAGAGTGGTTCCAGAGCGTTCAG
CGAGCGCTGCGGTGGAATACACGCGGTGCCGTGCAGAAGAGCTGGCACAGCTCTTCAGATGCGGGCCTCGAAGCC
ACCGAGGATGATGAAGACACCGAGTGGGACATCGATACCGATGCCGGGCTAACTGGCACGGACAGTGGCTTGGGG
GTCAGTGAGGATGGCGATGCAGGGTCTATCAGCCCTCTGAAGCGGCAAATGAGCATGTTCAGCACCTAG
Transcript >Ani_SJS100_1|g4808.t1
ATGGCGTCCTCCCCACTTGACCATGGCTCGATGAACCCTTCTTCTGCCTCGTCCTCCGATCCGCTGCCCGCGACC
GGCCCTCTGCCGTCGCCCTCAATATCTTTGCCCTCATCACCACCACCACCGCCGTCCTCCGCGGCCCCACCACTA
TCAGATCCTCCGGTGCGCCCTCCTCCTCCTTATCGCTCGGCCACTGTGGGAGCATCGCTCCTCCGCGACTATGCC
TTGCACATAGATCCTTCTCACACGACAAACGATATCCACGCAGCCGACTCGGCTCCCGAGTCTCCCAATCTGGGT
CTCGGCTCACTTCAGAAACCTGATCTTCCTCGTGAGGGTGCCGCTGGTCCCTCTTTCACCTCGTCCTTCCTGCCA
CGCCGGCAGACGGCCTCTCTAGCGGGCCATCATCGGAACGCGTTGTCTAACGATTCAATTCCTCGCCAAACCCTT
CTCAAAGCTCTCGCATCACGACCATCCATGTGCAACCACCAAAGCCCAAACATGCCGCTGGCGGCCTCTTTGGGG
CTTCTCAACACGAACCCTACCTCCTCGGAAGAAACGGAGCGCAACTCCAGCAATTCCTCGTCACAGATGCTCTCT
GCAGCTCTGTCCAATATTCAGCTAGGGACCTACCTGGACCGTTCTCCCGCGACAGCCCGGTTGGTTATGCAGTCA
CCATGCTTCTTCCACCAGCGTTTCGATGACGCCGTAAATATTCAGAAGGTATTGGAAGAGATTGCGGACGACGAG
TGGCTATCGCATTCCCGCCTGGTACAGACAGCGACTGGTGTCCGAGAGGTGTCGAAGCAATTGCAGCGTAGGCCA
ATCAAACGCGCTGTCAAGAATGTTATGATCGTCACCAAAGCACGCGATAATAGCCTGGTGCATCTGACCCGCGAA
TTGGCGGAATGGCTCCTCTCCACCCCTCGCTACGGCAACGATTTGGGTGTGAACGTCTACGTAGACGCTAAACTT
CGGAACTCACGAAGATTCGATGCACCGGGGCTCCTGGAGAAGGAACCCCGGTTCAAGGAGATGCTGCACTACTGG
ACCCCCGATCTCTGCTGGACAGCTCCCGAGAAATTCGATTTGGTCCTCACATTAGGAGGGGATGGGACCGTGCTT
TTCACATCCTGGCTCTTCCAGCGCATCGTCCCCCCGGTCCTCTGCTTTTCTCTGGGAAGCCTAGGGTTCCTGACG
AATTTCGAGTTTGAGAATTACAAGTCTCACCTGAATGCGGTCATGGGTGATGTAGACCGCAGCAAGGGCGCCGAG
GCGGGCGCCGTGGAGGAAGGGGAGCAGTTTGAGGTGTTGAACGAGCTCGTGATTGATCGAGGGCCGTCACCATAC
GTGTCAAACCTTGAACTGTACGCAGATAATGATCTGCTCACCGTGGTGCAAGCGGACGGGTGCATTTTCTCTACT
CCTACCGGTTCCACGGCATACTCTCTTTCCGCTGGCGGTTCCTTGATTCACCCCTCTATTCCCGGCATTCTTCTT
ACCCCCATTTGTCCCCATACACTTTCTTTCCGTCCCATGGTTCTCTCCGATACCCTGCTACTTCGTATTGCCGTT
CCCGCCGGGTCGCGGTCGACCGCGTACTGCTCGTTCGATGGCAAGGGTCGTGTGGAACTTCGCCAAGGCGACTAT
GTTACCGTCGAAGCAAGTCAATACCCCTTCCCGACCGTCGTGGCGGGTAGTGGAGAGTGGTTCCAGAGCGTTCAG
CGAGCGCTGCGGTGGAATACACGCGGTGCCGTGCAGAAGAGCTGGCACAGCTCTTCAGATGCGGGCCTCGAAGCC
ACCGAGGATGATGAAGACACCGAGTGGGACATCGATACCGATGCCGGGCTAACTGGCACGGACAGTGGCTTGGGG
GTCAGTGAGGATGGCGATGCAGGGTCTATCAGCCCTCTGAAGCGGCAAATGAGCATGTTCAGCACCTAG
Gene >Ani_SJS100_1|g4808.t1
ATGGCGTCCTCCCCACTTGACCATGGCTCGATGAACCCTTCTTCTGCCTCGTCCTCCGATCCGCTGCCCGCGACC
GGCCCTCTGCCGTCGCCCTCAATATCTTTGCCCTCATCACCACCACCACCGCCGTCCTCCGCGGCCCCACCACTA
TCAGATCCTCCGGTGCGCCCTCCTCCTCCTTATCGCTCGGCCACTGTGGGAGCATCGCTCCTCCGCGACTATGCC
TTGCACATAGATCCTTCTCACACGACAAACGATATCCACGCAGCCGACTCGGCTCCCGAGTCTCCCAATCTGGGT
CTCGGCTCACTTCAGAAACCTGATCTTCCTCGTGAGGGTGCCGCTGGTCCCTCTTTCACCTCGTCCTTCCTGCCA
CGCCGGCAGACGGCCTCTCTAGCGGGCCATCATCGGAACGCGTTGTCTAACGATTCAATTCCTCGCCAAACCCTT
CTCAAAGCTCTCGCATCACGACCATCCATGTGCAACCACCAAAGCCCAAACATGCCGCTGGCGGCCTCTTTGGGG
CTTCTCAACACGAACCCTACCTCCTCGGAAGAAACGGAGCGCAACTCCAGCAATTCCTCGTCACAGATGCTCTCT
GCAGCTCTGTCCAATATTCAGCTAGGGACCTACCTGGACCGTTCTCCCGCGACAGCCCGGTTGGTTATGCAGTCA
CCATGCTTCTTCCACCAGCGTTTCGATGACGCCGTAAATATTCAGAAGGTATTGGAAGAGATTGCGGACGACGAG
TGGCTATCGCATTCCCGCCTGGTACAGACAGCGACTGGTGTCCGAGAGGTGTCGAAGCAATTGCAGCGTAGGCCA
ATCAAACGCGCTGTCAAGAATGTTATGATCGTCACCAAAGCACGCGATAATAGCCTGGTGCATCTGACCCGCGAA
TTGGCGGAATGGCTCCTCTCCACCCCTCGCTACGGCAACGATTTGGGTGTGAACGTCTACGTAGACGCTAAACTT
CGGAACTCACGAAGATTCGATGCACCGGGGCTCCTGGAGAAGGAACCCCGGTTCAAGGAGATGCTGCACTACTGG
ACCCCCGATCTCTGCTGGACAGCTCCCGAGAAATTCGATTTGGTCCTCACATTAGGAGGGGATGGGACCGTGCTT
TTCACATCCTGGCTCTTCCAGCGCATCGTCCCCCCGGTCCTCTGCTTTTCTCTGGGAAGCCTAGGGTTCCTGACG
AATTTCGAGTTTGAGAATTACAAGTCTCACCTGAATGCGGTCATGGGTGATGTAGGTATGCGAGTGAATTTGCGG
ATGCGCTTTACTTGTACAGTTTTCCGTAAAGACCGCAGCAAGGGCGCCGAGGCGGGCGCCGTGGAGGAAGGGGAG
CAGTTTGAGGTGTTGAACGAGCTCGTGATTGATCGAGGGCCGTCACCATACGTGTCAAACCTTGAACTGTACGCA
GATAATGATCTGCTCACCGTGGTGCAAGCGGACGGGTGCATTTTCTCTACTCCTACCGGTACGTGTGACCCGCAA
AAACAACAGACTGATTTTCAAATCACCGACTGACATGTGGTCTCAGGTTCCACGGCATACTCTCTTTCCGCTGGC
GGTTCCTTGATTCACCCCTCTATTCCCGGCATTCTTCTTACCCCCATTTGTCCCCATACACTTTCTTTCCGTCCC
ATGGTTCTCTCCGATACCCTGCTACTTCGTATTGCCGTTCCCGCCGGGTCGCGGTCGACCGCGTACTGCTCGTTC
GATGGCAAGGGTCGTGTGGAACTTCGCCAAGGCGACTATGTTACCGTCGAAGCAAGTCAATACCCCTTCCCGACC
GTCGTGGCGGGTAGTGGAGAGTGGTTCCAGAGCGTTCAGCGAGCGCTGCGGTGGAATACACGCGGTGCCGTGCAG
AAGAGCTGGCACAGCTCTTCAGATGCGGGCCTCGAAGCCACCGAGGATGATGAAGACACCGAGTGGGACATCGAT
ACCGATGCCGGGCTAACTGGCACGGACAGTGGCTTGGGGGTCAGTGAGGATGGCGATGCAGGGTCTATCAGCCCT
CTGAAGCGGCAAATGAGCATGTTCAGCACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail