Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4798.t1
Gene name
Locationscaffold_025:187248..189057
Strand-
Gene length (bp)1809
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00450 Peptidase_S10 Serine carboxypeptidase 1.5E-94 51 498

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004185 serine-type carboxypeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0070008 serine-type exopeptidase activity No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008238 exopeptidase activity No
GO:0004180 carboxypeptidase activity No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4798.t1
MYYSLWVAALVAALPVSRAQFVAPPTDLIPTKGYLDIPVRYKQVPTGICETDPSVKSFSGYVDVAEHEHIFFWFF
EARNQDPTEAPLTVWINGGPGSSSMIGLFQEHGPCGIDANGSVYNNPYSWNNASNMLYIDQPVQTGFSYSIPVPG
YVDSSTDNVIALPSPACPDYAADMSCGTYSYPNVSLTANSTDNAAPNFYRALQGFMGAFPQYSRETFHFTTESYG
GHYGPVFNEYIEEQNAHLQPGAKKIQLGSVMIGNGWYDPIIQYQAYYNFTVYPGNTYDYLPFNKSISSLMYNNLY
GPGNCLDQLYDCAARGIDEICSTADDFCANEVENVYDIYSGRDEYDFRELTPDPFPYEFYVDYLNKASVQAAIGA
YINYTESNNAVGLAFSSTGDDGRLMNTIQDVGKLLKQGVTVVMYAGDADYNCNWLGGEAVSLQVKAANFSSAGYT
NIVTSDGVTHGQVRQAGQFAFVRVYESGHEVPFYQPLLALEMFERVIGGKDVATGKIPISSSLQTVGTPKSYYRE
GNSTIQWEVLDSLATYNTTTNAPNPVSRRLKRMGPALRFQM*
Coding >Ani_SJS100_1|g4798.t1
ATGTACTACTCTCTCTGGGTTGCTGCCTTGGTGGCCGCGCTGCCCGTCTCCCGGGCCCAGTTTGTGGCTCCGCCC
ACGGATCTCATTCCCACCAAGGGATATCTCGACATCCCCGTCCGCTACAAACAGGTCCCCACCGGCATTTGTGAG
ACTGATCCCAGTGTCAAGAGCTTCTCCGGTTACGTCGATGTCGCTGAGCATGAGCACATCTTCTTCTGGTTCTTC
GAGGCGCGCAACCAAGATCCCACCGAGGCTCCCTTGACCGTCTGGATCAATGGAGGTCCTGGTTCCTCCTCCATG
ATCGGCTTGTTCCAAGAGCACGGCCCATGCGGCATTGACGCCAATGGCTCCGTCTACAACAACCCCTACTCCTGG
AACAACGCCAGCAACATGCTCTACATCGACCAGCCCGTGCAGACCGGCTTCTCCTACAGCATTCCGGTTCCCGGC
TATGTGGATTCTTCCACAGACAATGTTATTGCTCTGCCCTCCCCCGCCTGCCCCGACTATGCAGCGGATATGTCC
TGTGGCACTTACTCCTACCCCAACGTGAGCCTTACGGCTAATTCCACCGACAACGCCGCCCCCAACTTCTACCGC
GCCCTACAGGGTTTTATGGGCGCATTTCCTCAGTACTCGCGCGAAACCTTCCACTTCACCACGGAGAGTTATGGC
GGCCACTACGGGCCCGTCTTCAACGAGTACATCGAGGAGCAGAACGCCCATCTCCAGCCGGGAGCCAAGAAGATC
CAACTGGGCAGTGTGATGATCGGCAATGGCTGGTATGACCCGATTATTCAATACCAGGCCTACTACAACTTTACG
GTATATCCGGGCAACACATACGACTACCTGCCATTCAACAAGTCCATCAGCTCGCTGATGTACAACAACCTCTAT
GGCCCCGGAAACTGCCTCGACCAGCTCTACGACTGCGCCGCCCGAGGCATCGACGAGATCTGCAGCACTGCCGAC
GATTTTTGCGCCAACGAGGTCGAAAACGTCTACGACATTTACTCCGGTCGGGATGAGTATGACTTTCGTGAACTC
ACTCCGGACCCGTTCCCTTACGAGTTCTACGTTGACTACCTGAACAAAGCGTCCGTGCAGGCCGCCATCGGCGCA
TACATCAATTACACGGAGAGCAACAACGCTGTTGGACTCGCCTTTTCGTCCACCGGTGACGACGGGCGACTCATG
AACACCATCCAGGATGTGGGCAAGCTGCTCAAACAGGGTGTCACGGTGGTCATGTACGCCGGGGATGCCGACTAT
AACTGCAACTGGCTGGGTGGGGAAGCCGTGTCGTTGCAGGTCAAGGCCGCCAACTTCAGTAGTGCGGGTTACACC
AACATTGTCACCTCGGATGGAGTGACACACGGCCAGGTGCGCCAGGCGGGGCAATTTGCCTTTGTGCGAGTGTAT
GAGAGTGGACATGAGGTTCCCTTCTATCAACCCTTGCTTGCGCTGGAGATGTTTGAGCGCGTCATTGGCGGCAAG
GATGTGGCGACGGGAAAGATTCCCATCTCGTCGAGTTTACAGACGGTGGGCACGCCCAAGAGTTACTACCGGGAG
GGCAACAGCACGATTCAGTGGGAGGTGTTGGATTCTCTGGCGACGTACAACACAACCACGAATGCTCCGAACCCG
GTGAGCCGGAGGCTGAAGCGGATGGGACCAGCTTTGCGGTTTCAGATGTAG
Transcript >Ani_SJS100_1|g4798.t1
ATGTACTACTCTCTCTGGGTTGCTGCCTTGGTGGCCGCGCTGCCCGTCTCCCGGGCCCAGTTTGTGGCTCCGCCC
ACGGATCTCATTCCCACCAAGGGATATCTCGACATCCCCGTCCGCTACAAACAGGTCCCCACCGGCATTTGTGAG
ACTGATCCCAGTGTCAAGAGCTTCTCCGGTTACGTCGATGTCGCTGAGCATGAGCACATCTTCTTCTGGTTCTTC
GAGGCGCGCAACCAAGATCCCACCGAGGCTCCCTTGACCGTCTGGATCAATGGAGGTCCTGGTTCCTCCTCCATG
ATCGGCTTGTTCCAAGAGCACGGCCCATGCGGCATTGACGCCAATGGCTCCGTCTACAACAACCCCTACTCCTGG
AACAACGCCAGCAACATGCTCTACATCGACCAGCCCGTGCAGACCGGCTTCTCCTACAGCATTCCGGTTCCCGGC
TATGTGGATTCTTCCACAGACAATGTTATTGCTCTGCCCTCCCCCGCCTGCCCCGACTATGCAGCGGATATGTCC
TGTGGCACTTACTCCTACCCCAACGTGAGCCTTACGGCTAATTCCACCGACAACGCCGCCCCCAACTTCTACCGC
GCCCTACAGGGTTTTATGGGCGCATTTCCTCAGTACTCGCGCGAAACCTTCCACTTCACCACGGAGAGTTATGGC
GGCCACTACGGGCCCGTCTTCAACGAGTACATCGAGGAGCAGAACGCCCATCTCCAGCCGGGAGCCAAGAAGATC
CAACTGGGCAGTGTGATGATCGGCAATGGCTGGTATGACCCGATTATTCAATACCAGGCCTACTACAACTTTACG
GTATATCCGGGCAACACATACGACTACCTGCCATTCAACAAGTCCATCAGCTCGCTGATGTACAACAACCTCTAT
GGCCCCGGAAACTGCCTCGACCAGCTCTACGACTGCGCCGCCCGAGGCATCGACGAGATCTGCAGCACTGCCGAC
GATTTTTGCGCCAACGAGGTCGAAAACGTCTACGACATTTACTCCGGTCGGGATGAGTATGACTTTCGTGAACTC
ACTCCGGACCCGTTCCCTTACGAGTTCTACGTTGACTACCTGAACAAAGCGTCCGTGCAGGCCGCCATCGGCGCA
TACATCAATTACACGGAGAGCAACAACGCTGTTGGACTCGCCTTTTCGTCCACCGGTGACGACGGGCGACTCATG
AACACCATCCAGGATGTGGGCAAGCTGCTCAAACAGGGTGTCACGGTGGTCATGTACGCCGGGGATGCCGACTAT
AACTGCAACTGGCTGGGTGGGGAAGCCGTGTCGTTGCAGGTCAAGGCCGCCAACTTCAGTAGTGCGGGTTACACC
AACATTGTCACCTCGGATGGAGTGACACACGGCCAGGTGCGCCAGGCGGGGCAATTTGCCTTTGTGCGAGTGTAT
GAGAGTGGACATGAGGTTCCCTTCTATCAACCCTTGCTTGCGCTGGAGATGTTTGAGCGCGTCATTGGCGGCAAG
GATGTGGCGACGGGAAAGATTCCCATCTCGTCGAGTTTACAGACGGTGGGCACGCCCAAGAGTTACTACCGGGAG
GGCAACAGCACGATTCAGTGGGAGGTGTTGGATTCTCTGGCGACGTACAACACAACCACGAATGCTCCGAACCCG
GTGAGCCGGAGGCTGAAGCGGATGGGACCAGCTTTGCGGTTTCAGATGTAG
Gene >Ani_SJS100_1|g4798.t1
ATGTACTACTCTCTCTGGGTTGCTGCCTTGGTGGCCGCGCTGCCCGTCTCCCGGGCCCAGTTTGTGGCTCCGCCC
ACGGATCTCATTCCCACCAAGGGATATCTCGACATCCCCGTCCGCTACAAACAGGTCCCCACCGGCATTTGTGAG
ACTGATCCCAGTGTCAAGAGCTTCTCCGGTTACGTCGATGTCGCTGAGCATGAGCACATCTTCTTCTGGTTCTTC
GAGGCGCGCAACCAAGATCCCACCGAGGCTCCCTTGACCGTCTGGATCAATGGAGGCATGTCTGACCCCGGTCAT
TATTTCCTTCCAATTGCTAACCGTTCGTAGGTCCTGGTTCCTCCTCCATGATCGGCTTGTTCCAAGAGCACGGCC
CATGCGGCATTGACGCCAATGGCTCCGTCTACAACAACCCCTACTCCTGGAACAACGCCAGCAACATGCTCTACA
TCGACCAGCCCGTGCAGACCGGCTTCTCCTACAGCATTCCGGTTCCCGGCTATGTGGATTCTTCCACAGACAATG
TTATTGCTCTGCCCTCCCCCGCCTGCCCCGACTATGCAGCGGATATGTCCTGTGGCACTTACTCCTACCCCAACG
TGAGCCTTACGGCTAATTCCACCGACAACGCCGCCCCCAACTTCTACCGCGCCCTACAGGGTTTTATGGGCGCAT
TTCCTCAGTACTCGCGCGAAACCTTCCACTTCACCACGGAGAGTTATGGCGGCCACTACGGGCCCGTCTTCAACG
AGTACATCGAGGAGCAGAACGCCCATCTCCAGCCGGGAGCCAAGAAGATCCAACTGGGCAGTGTGATGATCGGCA
ATGGCTGGTATGACCCGATTATTCAATACCAGGCCTACTACAACTTTACGGTACACTACCTGGTTTCTGATCCTT
ATCCTTACAGCCTGGACACTAATCTATCTACAGGTATATCCGGGCAACACATACGACTACCTGCCATTCAACAAG
TCCATCAGCTCGCTGATGTACAACAACCTCTATGGCCCCGGAAACTGCCTCGACCAGCTCTACGACTGCGCCGCC
CGAGGCATCGACGAGATCTGCAGCACTGCCGACGATTTTTGCGCCAACGAGGTCGAAAACGTCTACGACATTTAC
TCCGGTCGGGATGAGTATGACTTTCGTGAACTCACTCCGGACCCGTTCCCTTACGAGTTCTACGTTGACTACCTG
AACAAAGCGTCCGTGCAGGCCGCCATCGGCGCATACATCAATTACACGGAGAGCAACAACGCTGTTGGACTCGCC
TTTTCGTCCACCGGTGACGACGGGCGACTCATGAACACCATCCAGGATGTGGGCAAGCTGCTCAAACAGGGTGTC
ACGGTGGTCATGTACGCCGGGGATGCCGACTATAACTGCAACTGGCTGGGTGGGGAAGCCGTGTCGTTGCAGGTC
AAGGCCGCCAACTTCAGTAGTGCGGGTTACACCAACATTGTCACCTCGGATGGAGTGACACACGGCCAGGTGCGC
CAGGCGGGGCAATTTGCCTTTGTGCGAGTGTATGAGAGTGGACATGAGGTTCCCTTCTATCAACCCTTGCTTGCG
CTGGAGATGTTTGAGCGCGTCATTGGCGGCAAGGATGTGGCGACGGGAAAGATTCCCATCTCGTCGAGTTTACAG
ACGGTGGGCACGCCCAAGAGTTACTACCGGGAGGGCAACAGCACGATTCAGTGGGAGGTGTTGGATTCTCTGGCG
ACGTACAACACAACCACGAATGCTCCGAACCCGGTGAGCCGGAGGCTGAAGCGGATGGGACCAGCTTTGCGGTTT
CAGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail