Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4779.t1
Gene name
Locationscaffold_025:132981..140908
Strand+
Gene length (bp)7927
Transcript length (bp)6786
Coding sequence length (bp)6786
Protein length (aa) 2262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.2E-77 513 762
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 3.5E-69 148 381
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.7E-33 771 887
PF00698 Acyl_transf_1 Acyl transferase domain 4.3E-32 1048 1327
PF00550 PP-binding Phosphopantetheine attachment site 3.5E-14 1806 1870
PF00550 PP-binding Phosphopantetheine attachment site 8.1E-12 1913 1975
PF00975 Thioesterase Thioesterase domain 7.4E-25 2021 2131
PF07110 EthD EthD domain 6.1E-22 16 113
PF14765 PS-DH Polyketide synthase dehydratase 1.3E-16 1442 1742

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4779.t1
MASERLYALTIYGYRKPGMPEDEYHRYLSEHHAVLVRNHLVKMGIVRYTLTHNTSETKEMMKRIFGDLPEGHTSD
CDCLAQIMFRDVEDYVRARNDPHYKEVIFPDHANFADSTSNCMNMVIRTMPEESNTKTNTSATSKMETVAEVFLF
GDQTVVFESTLHSLLHVKDNAVLTDFFDRVGFQLRRHVGNLPLHQQEWFPYFTTLIDLLAQHENCYAAPALKLPL
LCATELGQFIRHYGQAGRTYPAPESTFLIGACTGAFAAAAVATSLTLAELVPAAVEAVTVAFRTALRSLILRSDL
VPTVEETPEPWSAIVGVSETEATSAIQGFNAEKGLPPVYRLYLSSVSRTNVSISGPPHLLGQFLSSYAWKHSFLP
IELPYHASHLFRKADADVIVDDIHDSSLLKYTLRTKVISAVSGEIITASDLRSLLLRAVQEALCEPLQWNRITAS
LSRELKQGQFTDCVINQVSSRSGTLLSSALSQEAFLQVKIVQSIGDASVHSALSSPTGKFSQSSIAIIGFSGRFP
ESGSNEEFWEMLLAGRDVHRIIPEDRFDWKAHYDPTGKTKNTSRVKYGCFIKEPGMFDARFFNMSPREAENADPA
QRLAITTAYEAMEMAGLVPNTTPSTQGDRIGVFYGVTSDDWREVNSGQNVDTYFIPGGNRAFIPGRISYFFRFCG
PSLSIDTACSSSCAAIQTACAYLWRGECDTALAGGVNVLTNPDNFCGLDRGHFLTAKGNCNAFDDEADGYCRSDA
VGTVILKRLEDALEDNDPIFGVIRGAYTNHCGRTDSITRPFEGDQATVFNRIMRYAGVNPQDVGYVEMHGTGTQA
GDATEMKSVLSVFAPNMRRQNALYLGTAKANMGHAESASGVSSLIKVLLMMRNDTIPPHCGIKTRINHTYPIDLA
QRNVHIPFKPTPWLREQMPQLKRTVFLNNFSAAGGNTAMLLEDAPVRKSNKAADPRSKHVVTVTAKTIKSLRGNI
SSLLAYLEQHPSISLSSLSYTTTARRIHHSYRVIVSGSDTGEFIHRMQEILPGLESHRPVPPPGKLPNIVMTFSG
QGTLSVGMGKQFYDTVPSFREDVTRFDDIASQMGFPSFLPLIDGSMVNHQEANPTVAHLALVCVQMALYNYWRSL
GVVPSATIGHSLGEYPALYAAGVLTASSVIYVVGARAALLSEKTTPRTHAMLAVKGSVESIQGELHNRGCALACL
NQPFSNVVSGTVGELILLKDWLTSQGIGSVQLDIPYAFHSVQVDPILNDFKTISAGVEYYVSSIPYISPLLSRVI
PAGEPDVLNASYLRNACREPVNFQGAVVSAEETGLVNEKTIWLDIGSHPACSGMIKGILGTKSTTIASLRKGSDS
WAVLTASLEVLYSHGIDIQWVEYHRGVIGSREVLQLPRYGWDLKNYWIPYRNNFCLLKGEGLIPAEQQVVLPHME
APRIPKYISPSVQRILEQNDSPEMSTLSAESDIHDARLAPILAGHVVNGAMLCPSSLYADIGITISKHMLQAIGK
YTAAVGLDVADMQVQNPLVSRPDTESQLFRVSASADWRINEIAFRLYSVNRTGRKTAEHAAFVVHITDQVQTWLS
EWKRHAYLVRSRIASLHRSAEEGDAHKLKRRLAYQLFATLVQYEKSYQGMQEVVLDSDNHEATAKVSFQIDEDGF
VFNPCWIDSLGHIAGFIMNASDASPSKEQVFINHGWERMRCAVRFVNGKQYQVYNRMQLETGTTYVGDTYIFEGE
TVVAVFQGIRFQGVPRRLLDRLLPPKIPFSGPSERTQEVRPTTAPINHQPVCRRAGPKSVPLVPAPKPKEPMGSS
SGIAARVMAIIAKEAGVDPSALGPNEEFANYGIDSLLSLTICGQIQEELDVDVPSSLFVDYPTPKDLIGFFGVED
DSSQLTSSLEGSTEDDTSSYETVATSEHDSEVPVLEILRTTIAREAGVPTNELTPSTAFSDIGVDSLLALTIVST
IAETYDIALPSNILMEKENLEEVGKALGLEISPKTSLQHTMLSRPAFDPSAGPQATSILLWGKPKSAKKVLFLFP
DGSGSATSYSALPKLGNDTAAFGLNCPWMKTPEQMTVTLEELTAKYLLEVRRRQPNGPYYLGGWSAGGICAYEAA
RQLAQDGQTTAKLILIDSPNPIGMENPPERMYDFFQRIGLFGTSGKPPPRWLIPHFNAFIRLLDAYRIQALETSI
ETHIVYARDGICKNASSPRPERRPDDPREMVWLIENRTDFSGDGWASLLGRDNLQIEVLNEVNHFSMMDPGEHME
AFERFLRRALL*
Coding >Ani_SJS100_1|g4779.t1
ATGGCCTCTGAACGCCTCTACGCTTTGACAATCTATGGCTATCGCAAGCCAGGTATGCCTGAAGATGAATACCAT
CGCTACCTGAGTGAGCACCATGCCGTTCTGGTGAGGAATCATCTCGTGAAGATGGGTATTGTCAGATACACTCTG
ACGCACAACACATCCGAGACAAAGGAGATGATGAAGCGTATCTTTGGAGACCTTCCAGAGGGACATACCTCTGAT
TGTGACTGCTTGGCCCAGATTATGTTTCGTGATGTGGAGGATTATGTCCGCGCTCGGAATGACCCCCACTATAAG
GAGGTTATCTTTCCCGATCATGCCAACTTTGCCGACTCAACTTCCAATTGTATGAACATGGTCATTCGGACAATG
CCGGAAGAATCGAACACAAAAACGAATACCTCAGCAACTAGCAAGATGGAGACAGTCGCCGAGGTATTCCTCTTC
GGTGATCAAACGGTAGTGTTTGAGTCGACGCTACACTCGTTGTTGCATGTCAAGGACAATGCAGTTCTAACCGAC
TTCTTTGATCGGGTTGGGTTCCAGTTGCGGCGACACGTTGGGAATCTCCCTTTGCATCAGCAGGAATGGTTCCCT
TACTTTACTACCCTCATTGATTTGCTTGCCCAGCACGAAAATTGCTATGCGGCTCCGGCATTAAAGTTGCCCCTG
CTATGTGCGACCGAGCTTGGCCAGTTTATTAGGCACTATGGACAAGCAGGGAGAACATATCCTGCACCAGAAAGT
ACCTTCCTAATAGGGGCCTGCACAGGAGCCTTTGCTGCTGCTGCAGTTGCAACTTCCCTAACCTTAGCAGAGCTT
GTCCCTGCTGCGGTTGAAGCCGTCACCGTTGCGTTCCGGACGGCGCTGCGATCACTGATCCTACGAAGTGATCTT
GTACCCACCGTAGAAGAAACTCCGGAACCATGGTCTGCTATTGTAGGTGTCAGTGAGACTGAAGCAACAAGTGCG
ATTCAGGGCTTTAACGCCGAGAAGGGGTTGCCTCCCGTATATCGTCTATACCTCAGCTCAGTCAGTCGAACAAAT
GTTTCGATCAGTGGTCCTCCACATCTTCTGGGCCAGTTCCTTTCGTCCTACGCCTGGAAGCACTCGTTCCTTCCG
ATTGAGCTGCCGTACCACGCGTCGCATCTTTTCCGGAAGGCCGATGCGGATGTTATCGTGGATGATATCCACGAC
TCCTCACTGCTAAAGTACACGCTGCGAACAAAAGTTATTTCCGCTGTTTCCGGTGAAATTATCACAGCGTCTGAC
CTGCGCAGTCTGCTGCTTCGAGCGGTTCAGGAAGCCCTCTGTGAGCCCCTCCAGTGGAATCGCATAACTGCATCT
CTTTCTCGGGAGTTAAAGCAGGGCCAATTCACCGACTGTGTAATAAATCAAGTTTCATCACGAAGCGGAACGCTT
CTCAGCTCAGCTCTATCACAAGAAGCGTTTCTCCAAGTTAAAATCGTGCAATCCATAGGGGATGCCTCTGTACAC
TCTGCTCTCTCGAGCCCAACAGGCAAATTTTCGCAATCAAGCATTGCCATTATCGGCTTCTCTGGGCGCTTCCCC
GAATCTGGCTCTAATGAAGAATTTTGGGAGATGCTTTTGGCGGGCCGAGATGTACATCGGATTATCCCCGAGGAT
CGGTTCGACTGGAAGGCCCACTACGATCCCACTGGCAAGACCAAGAACACCAGTCGCGTCAAATATGGTTGCTTT
ATCAAGGAACCTGGAATGTTCGATGCTCGCTTCTTCAATATGTCTCCCCGGGAGGCCGAGAACGCAGATCCGGCA
CAGCGATTGGCCATCACTACAGCATATGAGGCAATGGAAATGGCGGGACTGGTGCCAAACACGACACCATCCACC
CAGGGAGATCGCATCGGGGTGTTTTACGGGGTGACGAGTGATGACTGGCGCGAAGTGAATAGCGGGCAGAATGTG
GATACGTACTTTATCCCGGGGGGAAATCGCGCATTCATTCCGGGAAGGATCAGCTATTTCTTCCGATTCTGTGGC
CCCAGCCTGAGTATCGACACAGCATGCTCATCCAGCTGCGCGGCGATTCAAACGGCGTGTGCCTACCTATGGCGA
GGTGAATGCGACACAGCCCTGGCTGGAGGCGTGAATGTATTGACGAACCCTGATAACTTCTGTGGACTAGATAGG
GGGCATTTCCTGACCGCTAAAGGCAATTGCAATGCTTTCGATGATGAAGCAGATGGATACTGCCGATCGGACGCC
GTTGGGACCGTTATTCTCAAACGCCTAGAGGACGCCCTCGAGGATAACGATCCCATATTTGGGGTCATCCGTGGC
GCATACACCAACCATTGTGGTCGGACAGACTCCATCACTCGACCCTTTGAAGGCGATCAGGCGACTGTATTCAAC
CGAATTATGCGCTATGCTGGAGTTAACCCCCAAGACGTGGGTTACGTCGAAATGCACGGCACTGGAACCCAGGCC
GGGGATGCCACGGAGATGAAGTCAGTGCTGTCTGTATTTGCGCCTAATATGCGCAGGCAAAATGCTCTGTACTTG
GGAACAGCAAAAGCTAATATGGGCCATGCCGAGTCTGCTTCGGGTGTTTCGTCTTTGATCAAGGTCCTATTGATG
ATGCGGAACGATACGATCCCACCGCATTGTGGTATCAAGACCCGGATAAATCATACCTATCCAATTGACCTGGCA
CAGCGAAACGTGCATATTCCATTCAAACCTACACCTTGGCTTCGTGAACAGATGCCCCAACTCAAGCGGACAGTA
TTCTTGAATAATTTCAGTGCAGCCGGAGGCAATACTGCCATGCTACTCGAAGATGCCCCAGTTCGAAAAAGTAAT
AAGGCCGCGGACCCTCGCTCCAAGCACGTAGTGACAGTGACAGCGAAAACGATCAAATCCCTCAGGGGGAATATC
AGCTCTCTTCTGGCATACTTGGAGCAACATCCGAGTATATCCTTGTCATCTTTATCCTACACCACCACTGCCCGA
CGTATCCACCATAGCTATAGGGTCATAGTGTCAGGTTCTGACACCGGGGAATTTATACACCGGATGCAAGAGATC
TTGCCTGGCTTGGAGAGCCACAGGCCAGTCCCTCCACCGGGAAAGCTCCCAAACATCGTTATGACGTTCAGCGGA
CAGGGCACCCTCTCGGTCGGCATGGGAAAGCAGTTCTACGACACGGTGCCCTCGTTTAGGGAGGACGTTACGCGA
TTCGACGACATCGCGAGCCAAATGGGCTTTCCAAGCTTCTTGCCTCTTATTGATGGTAGCATGGTTAACCATCAG
GAAGCAAACCCCACCGTAGCCCACCTGGCCCTGGTCTGCGTTCAGATGGCACTATACAACTACTGGAGGTCTCTA
GGGGTTGTTCCATCGGCAACTATTGGTCACAGCCTCGGCGAATACCCGGCGCTGTATGCTGCTGGTGTCCTTACA
GCCTCGAGTGTAATATATGTGGTGGGCGCTCGGGCTGCCTTGCTATCAGAAAAGACTACCCCACGGACCCATGCT
ATGTTGGCAGTAAAAGGGTCCGTTGAGTCTATACAGGGCGAGTTACATAACAGGGGGTGCGCTTTGGCTTGCCTG
AACCAACCTTTCAGCAATGTTGTGAGCGGAACGGTTGGAGAGTTAATATTGTTGAAGGATTGGCTCACATCTCAG
GGCATCGGGAGTGTCCAACTGGACATACCGTATGCCTTTCACTCCGTACAAGTGGATCCAATTCTAAACGACTTT
AAGACGATCTCTGCGGGGGTTGAATACTACGTATCCTCTATTCCTTACATCTCTCCTCTTCTTAGTAGGGTCATC
CCTGCCGGCGAGCCAGATGTTCTTAATGCTTCCTATTTGAGAAACGCATGTCGTGAGCCAGTCAACTTTCAGGGT
GCTGTTGTATCAGCAGAGGAGACTGGTCTAGTTAACGAGAAAACCATATGGTTGGATATCGGCTCGCATCCAGCT
TGCTCAGGCATGATCAAGGGCATATTGGGCACAAAAAGCACCACGATCGCATCGCTTCGAAAAGGGTCAGATTCA
TGGGCTGTGCTAACCGCAAGCCTGGAGGTTCTGTACTCCCATGGCATCGATATCCAGTGGGTTGAGTATCATCGC
GGGGTGATTGGTTCTCGGGAGGTACTCCAATTGCCACGGTATGGTTGGGATCTGAAAAACTACTGGATTCCATAC
AGGAACAACTTCTGTCTCTTGAAGGGTGAAGGCCTCATTCCTGCGGAACAGCAAGTAGTGTTGCCACATATGGAG
GCTCCACGTATTCCCAAGTATATTTCTCCGTCTGTCCAGAGAATTCTCGAGCAAAACGACAGCCCAGAAATGTCA
ACTCTTTCGGCCGAGTCAGATATTCACGACGCAAGACTGGCGCCAATACTGGCAGGTCACGTCGTGAATGGCGCA
ATGTTATGTCCATCGTCTCTCTACGCCGATATTGGCATAACAATCTCAAAGCACATGTTGCAAGCAATTGGAAAA
TACACCGCGGCAGTCGGATTGGACGTCGCCGACATGCAGGTGCAGAACCCATTGGTTTCCCGGCCTGACACCGAA
TCGCAGCTCTTCCGTGTGTCTGCGTCGGCGGACTGGAGAATCAATGAGATTGCCTTCCGGCTGTATAGTGTCAAC
CGCACCGGTAGAAAGACTGCCGAGCACGCTGCATTTGTCGTACATATTACCGACCAGGTGCAGACCTGGCTGTCT
GAATGGAAGCGGCATGCATATTTAGTGCGAAGTCGGATTGCTTCTCTACATCGGAGCGCGGAAGAAGGCGACGCA
CACAAACTCAAGCGACGCTTAGCATACCAGTTGTTCGCCACTCTTGTGCAATATGAAAAAAGCTACCAGGGAATG
CAGGAGGTGGTTCTAGACAGCGATAATCATGAAGCTACTGCCAAGGTGTCTTTTCAAATTGACGAAGACGGCTTC
GTGTTCAATCCGTGCTGGATAGACAGTCTTGGGCATATTGCCGGATTCATCATGAATGCCAGCGATGCCAGTCCT
TCTAAAGAGCAGGTCTTTATCAACCATGGCTGGGAGCGCATGCGATGCGCCGTGCGATTTGTCAACGGCAAGCAG
TACCAAGTGTATAACCGCATGCAGCTGGAGACTGGGACGACCTACGTGGGTGATACATACATCTTTGAGGGCGAG
ACCGTTGTTGCAGTGTTTCAAGGGATCCGATTCCAAGGGGTCCCTCGACGACTTCTTGACCGACTGCTGCCTCCT
AAGATCCCATTTTCTGGCCCCTCTGAGAGGACACAAGAAGTGCGACCAACAACAGCGCCGATCAATCATCAACCG
GTGTGCCGGAGAGCTGGTCCAAAATCTGTACCCCTAGTTCCCGCTCCGAAGCCCAAGGAGCCAATGGGTTCGTCG
AGTGGTATCGCAGCGCGCGTCATGGCCATAATCGCCAAGGAAGCAGGCGTCGATCCATCAGCCTTGGGACCTAAT
GAAGAATTCGCCAATTACGGAATTGACTCTCTGCTGTCGCTGACCATCTGCGGTCAGATTCAAGAGGAGCTGGAC
GTTGATGTTCCGTCTTCGTTGTTCGTAGACTATCCCACTCCCAAGGATCTGATCGGCTTCTTTGGCGTTGAAGAT
GACTCTTCTCAGCTCACGTCTTCCTTGGAGGGGAGTACTGAGGATGACACATCAAGCTATGAAACTGTTGCAACA
TCAGAGCACGATTCGGAAGTGCCTGTATTGGAGATTCTTCGGACCACGATTGCCCGGGAAGCGGGCGTACCAACC
AATGAGCTGACGCCCTCCACGGCGTTCTCTGATATCGGGGTGGACTCATTGCTTGCCCTTACCATTGTGAGCACA
ATAGCAGAGACATACGACATAGCTCTTCCTTCTAATATTTTGATGGAGAAGGAGAACCTGGAAGAGGTTGGAAAG
GCACTTGGTCTGGAAATTAGCCCGAAGACTTCCCTACAGCATACAATGCTCTCTAGGCCTGCCTTCGATCCATCT
GCTGGTCCACAAGCCACATCCATCTTGCTGTGGGGTAAGCCCAAGTCAGCCAAAAAGGTACTATTTCTCTTCCCC
GATGGATCAGGGTCAGCCACGTCTTACTCCGCTCTTCCCAAGCTTGGCAACGACACGGCTGCGTTCGGGCTGAAC
TGCCCATGGATGAAGACACCGGAGCAGATGACAGTCACCCTTGAGGAATTGACAGCAAAGTATCTTCTGGAAGTG
CGTCGACGCCAGCCAAACGGTCCGTACTACCTGGGCGGCTGGTCCGCCGGAGGGATTTGCGCTTACGAAGCTGCG
CGCCAGCTCGCGCAAGACGGTCAGACTACGGCCAAGCTCATCCTTATCGACTCACCCAATCCGATCGGTATGGAA
AATCCTCCCGAGAGGATGTATGATTTCTTCCAGAGAATCGGTCTCTTTGGGACTAGTGGCAAGCCGCCTCCACGT
TGGCTAATCCCACACTTCAATGCTTTTATTCGGTTGCTGGACGCATATCGTATCCAAGCACTGGAAACGTCAATT
GAGACTCACATTGTCTATGCACGCGACGGAATCTGCAAGAATGCTAGCAGCCCTCGGCCGGAGCGACGGCCAGAT
GACCCGCGTGAGATGGTCTGGCTTATTGAGAATCGGACGGACTTTAGTGGGGATGGGTGGGCATCGCTGTTGGGA
AGGGACAACCTCCAGATTGAGGTCCTAAATGAGGTCAATCATTTCTCGATGATGGATCCGGGTGAGCACATGGAG
GCGTTCGAGCGGTTCCTTCGCCGGGCTTTGTTGTAG
Transcript >Ani_SJS100_1|g4779.t1
ATGGCCTCTGAACGCCTCTACGCTTTGACAATCTATGGCTATCGCAAGCCAGGTATGCCTGAAGATGAATACCAT
CGCTACCTGAGTGAGCACCATGCCGTTCTGGTGAGGAATCATCTCGTGAAGATGGGTATTGTCAGATACACTCTG
ACGCACAACACATCCGAGACAAAGGAGATGATGAAGCGTATCTTTGGAGACCTTCCAGAGGGACATACCTCTGAT
TGTGACTGCTTGGCCCAGATTATGTTTCGTGATGTGGAGGATTATGTCCGCGCTCGGAATGACCCCCACTATAAG
GAGGTTATCTTTCCCGATCATGCCAACTTTGCCGACTCAACTTCCAATTGTATGAACATGGTCATTCGGACAATG
CCGGAAGAATCGAACACAAAAACGAATACCTCAGCAACTAGCAAGATGGAGACAGTCGCCGAGGTATTCCTCTTC
GGTGATCAAACGGTAGTGTTTGAGTCGACGCTACACTCGTTGTTGCATGTCAAGGACAATGCAGTTCTAACCGAC
TTCTTTGATCGGGTTGGGTTCCAGTTGCGGCGACACGTTGGGAATCTCCCTTTGCATCAGCAGGAATGGTTCCCT
TACTTTACTACCCTCATTGATTTGCTTGCCCAGCACGAAAATTGCTATGCGGCTCCGGCATTAAAGTTGCCCCTG
CTATGTGCGACCGAGCTTGGCCAGTTTATTAGGCACTATGGACAAGCAGGGAGAACATATCCTGCACCAGAAAGT
ACCTTCCTAATAGGGGCCTGCACAGGAGCCTTTGCTGCTGCTGCAGTTGCAACTTCCCTAACCTTAGCAGAGCTT
GTCCCTGCTGCGGTTGAAGCCGTCACCGTTGCGTTCCGGACGGCGCTGCGATCACTGATCCTACGAAGTGATCTT
GTACCCACCGTAGAAGAAACTCCGGAACCATGGTCTGCTATTGTAGGTGTCAGTGAGACTGAAGCAACAAGTGCG
ATTCAGGGCTTTAACGCCGAGAAGGGGTTGCCTCCCGTATATCGTCTATACCTCAGCTCAGTCAGTCGAACAAAT
GTTTCGATCAGTGGTCCTCCACATCTTCTGGGCCAGTTCCTTTCGTCCTACGCCTGGAAGCACTCGTTCCTTCCG
ATTGAGCTGCCGTACCACGCGTCGCATCTTTTCCGGAAGGCCGATGCGGATGTTATCGTGGATGATATCCACGAC
TCCTCACTGCTAAAGTACACGCTGCGAACAAAAGTTATTTCCGCTGTTTCCGGTGAAATTATCACAGCGTCTGAC
CTGCGCAGTCTGCTGCTTCGAGCGGTTCAGGAAGCCCTCTGTGAGCCCCTCCAGTGGAATCGCATAACTGCATCT
CTTTCTCGGGAGTTAAAGCAGGGCCAATTCACCGACTGTGTAATAAATCAAGTTTCATCACGAAGCGGAACGCTT
CTCAGCTCAGCTCTATCACAAGAAGCGTTTCTCCAAGTTAAAATCGTGCAATCCATAGGGGATGCCTCTGTACAC
TCTGCTCTCTCGAGCCCAACAGGCAAATTTTCGCAATCAAGCATTGCCATTATCGGCTTCTCTGGGCGCTTCCCC
GAATCTGGCTCTAATGAAGAATTTTGGGAGATGCTTTTGGCGGGCCGAGATGTACATCGGATTATCCCCGAGGAT
CGGTTCGACTGGAAGGCCCACTACGATCCCACTGGCAAGACCAAGAACACCAGTCGCGTCAAATATGGTTGCTTT
ATCAAGGAACCTGGAATGTTCGATGCTCGCTTCTTCAATATGTCTCCCCGGGAGGCCGAGAACGCAGATCCGGCA
CAGCGATTGGCCATCACTACAGCATATGAGGCAATGGAAATGGCGGGACTGGTGCCAAACACGACACCATCCACC
CAGGGAGATCGCATCGGGGTGTTTTACGGGGTGACGAGTGATGACTGGCGCGAAGTGAATAGCGGGCAGAATGTG
GATACGTACTTTATCCCGGGGGGAAATCGCGCATTCATTCCGGGAAGGATCAGCTATTTCTTCCGATTCTGTGGC
CCCAGCCTGAGTATCGACACAGCATGCTCATCCAGCTGCGCGGCGATTCAAACGGCGTGTGCCTACCTATGGCGA
GGTGAATGCGACACAGCCCTGGCTGGAGGCGTGAATGTATTGACGAACCCTGATAACTTCTGTGGACTAGATAGG
GGGCATTTCCTGACCGCTAAAGGCAATTGCAATGCTTTCGATGATGAAGCAGATGGATACTGCCGATCGGACGCC
GTTGGGACCGTTATTCTCAAACGCCTAGAGGACGCCCTCGAGGATAACGATCCCATATTTGGGGTCATCCGTGGC
GCATACACCAACCATTGTGGTCGGACAGACTCCATCACTCGACCCTTTGAAGGCGATCAGGCGACTGTATTCAAC
CGAATTATGCGCTATGCTGGAGTTAACCCCCAAGACGTGGGTTACGTCGAAATGCACGGCACTGGAACCCAGGCC
GGGGATGCCACGGAGATGAAGTCAGTGCTGTCTGTATTTGCGCCTAATATGCGCAGGCAAAATGCTCTGTACTTG
GGAACAGCAAAAGCTAATATGGGCCATGCCGAGTCTGCTTCGGGTGTTTCGTCTTTGATCAAGGTCCTATTGATG
ATGCGGAACGATACGATCCCACCGCATTGTGGTATCAAGACCCGGATAAATCATACCTATCCAATTGACCTGGCA
CAGCGAAACGTGCATATTCCATTCAAACCTACACCTTGGCTTCGTGAACAGATGCCCCAACTCAAGCGGACAGTA
TTCTTGAATAATTTCAGTGCAGCCGGAGGCAATACTGCCATGCTACTCGAAGATGCCCCAGTTCGAAAAAGTAAT
AAGGCCGCGGACCCTCGCTCCAAGCACGTAGTGACAGTGACAGCGAAAACGATCAAATCCCTCAGGGGGAATATC
AGCTCTCTTCTGGCATACTTGGAGCAACATCCGAGTATATCCTTGTCATCTTTATCCTACACCACCACTGCCCGA
CGTATCCACCATAGCTATAGGGTCATAGTGTCAGGTTCTGACACCGGGGAATTTATACACCGGATGCAAGAGATC
TTGCCTGGCTTGGAGAGCCACAGGCCAGTCCCTCCACCGGGAAAGCTCCCAAACATCGTTATGACGTTCAGCGGA
CAGGGCACCCTCTCGGTCGGCATGGGAAAGCAGTTCTACGACACGGTGCCCTCGTTTAGGGAGGACGTTACGCGA
TTCGACGACATCGCGAGCCAAATGGGCTTTCCAAGCTTCTTGCCTCTTATTGATGGTAGCATGGTTAACCATCAG
GAAGCAAACCCCACCGTAGCCCACCTGGCCCTGGTCTGCGTTCAGATGGCACTATACAACTACTGGAGGTCTCTA
GGGGTTGTTCCATCGGCAACTATTGGTCACAGCCTCGGCGAATACCCGGCGCTGTATGCTGCTGGTGTCCTTACA
GCCTCGAGTGTAATATATGTGGTGGGCGCTCGGGCTGCCTTGCTATCAGAAAAGACTACCCCACGGACCCATGCT
ATGTTGGCAGTAAAAGGGTCCGTTGAGTCTATACAGGGCGAGTTACATAACAGGGGGTGCGCTTTGGCTTGCCTG
AACCAACCTTTCAGCAATGTTGTGAGCGGAACGGTTGGAGAGTTAATATTGTTGAAGGATTGGCTCACATCTCAG
GGCATCGGGAGTGTCCAACTGGACATACCGTATGCCTTTCACTCCGTACAAGTGGATCCAATTCTAAACGACTTT
AAGACGATCTCTGCGGGGGTTGAATACTACGTATCCTCTATTCCTTACATCTCTCCTCTTCTTAGTAGGGTCATC
CCTGCCGGCGAGCCAGATGTTCTTAATGCTTCCTATTTGAGAAACGCATGTCGTGAGCCAGTCAACTTTCAGGGT
GCTGTTGTATCAGCAGAGGAGACTGGTCTAGTTAACGAGAAAACCATATGGTTGGATATCGGCTCGCATCCAGCT
TGCTCAGGCATGATCAAGGGCATATTGGGCACAAAAAGCACCACGATCGCATCGCTTCGAAAAGGGTCAGATTCA
TGGGCTGTGCTAACCGCAAGCCTGGAGGTTCTGTACTCCCATGGCATCGATATCCAGTGGGTTGAGTATCATCGC
GGGGTGATTGGTTCTCGGGAGGTACTCCAATTGCCACGGTATGGTTGGGATCTGAAAAACTACTGGATTCCATAC
AGGAACAACTTCTGTCTCTTGAAGGGTGAAGGCCTCATTCCTGCGGAACAGCAAGTAGTGTTGCCACATATGGAG
GCTCCACGTATTCCCAAGTATATTTCTCCGTCTGTCCAGAGAATTCTCGAGCAAAACGACAGCCCAGAAATGTCA
ACTCTTTCGGCCGAGTCAGATATTCACGACGCAAGACTGGCGCCAATACTGGCAGGTCACGTCGTGAATGGCGCA
ATGTTATGTCCATCGTCTCTCTACGCCGATATTGGCATAACAATCTCAAAGCACATGTTGCAAGCAATTGGAAAA
TACACCGCGGCAGTCGGATTGGACGTCGCCGACATGCAGGTGCAGAACCCATTGGTTTCCCGGCCTGACACCGAA
TCGCAGCTCTTCCGTGTGTCTGCGTCGGCGGACTGGAGAATCAATGAGATTGCCTTCCGGCTGTATAGTGTCAAC
CGCACCGGTAGAAAGACTGCCGAGCACGCTGCATTTGTCGTACATATTACCGACCAGGTGCAGACCTGGCTGTCT
GAATGGAAGCGGCATGCATATTTAGTGCGAAGTCGGATTGCTTCTCTACATCGGAGCGCGGAAGAAGGCGACGCA
CACAAACTCAAGCGACGCTTAGCATACCAGTTGTTCGCCACTCTTGTGCAATATGAAAAAAGCTACCAGGGAATG
CAGGAGGTGGTTCTAGACAGCGATAATCATGAAGCTACTGCCAAGGTGTCTTTTCAAATTGACGAAGACGGCTTC
GTGTTCAATCCGTGCTGGATAGACAGTCTTGGGCATATTGCCGGATTCATCATGAATGCCAGCGATGCCAGTCCT
TCTAAAGAGCAGGTCTTTATCAACCATGGCTGGGAGCGCATGCGATGCGCCGTGCGATTTGTCAACGGCAAGCAG
TACCAAGTGTATAACCGCATGCAGCTGGAGACTGGGACGACCTACGTGGGTGATACATACATCTTTGAGGGCGAG
ACCGTTGTTGCAGTGTTTCAAGGGATCCGATTCCAAGGGGTCCCTCGACGACTTCTTGACCGACTGCTGCCTCCT
AAGATCCCATTTTCTGGCCCCTCTGAGAGGACACAAGAAGTGCGACCAACAACAGCGCCGATCAATCATCAACCG
GTGTGCCGGAGAGCTGGTCCAAAATCTGTACCCCTAGTTCCCGCTCCGAAGCCCAAGGAGCCAATGGGTTCGTCG
AGTGGTATCGCAGCGCGCGTCATGGCCATAATCGCCAAGGAAGCAGGCGTCGATCCATCAGCCTTGGGACCTAAT
GAAGAATTCGCCAATTACGGAATTGACTCTCTGCTGTCGCTGACCATCTGCGGTCAGATTCAAGAGGAGCTGGAC
GTTGATGTTCCGTCTTCGTTGTTCGTAGACTATCCCACTCCCAAGGATCTGATCGGCTTCTTTGGCGTTGAAGAT
GACTCTTCTCAGCTCACGTCTTCCTTGGAGGGGAGTACTGAGGATGACACATCAAGCTATGAAACTGTTGCAACA
TCAGAGCACGATTCGGAAGTGCCTGTATTGGAGATTCTTCGGACCACGATTGCCCGGGAAGCGGGCGTACCAACC
AATGAGCTGACGCCCTCCACGGCGTTCTCTGATATCGGGGTGGACTCATTGCTTGCCCTTACCATTGTGAGCACA
ATAGCAGAGACATACGACATAGCTCTTCCTTCTAATATTTTGATGGAGAAGGAGAACCTGGAAGAGGTTGGAAAG
GCACTTGGTCTGGAAATTAGCCCGAAGACTTCCCTACAGCATACAATGCTCTCTAGGCCTGCCTTCGATCCATCT
GCTGGTCCACAAGCCACATCCATCTTGCTGTGGGGTAAGCCCAAGTCAGCCAAAAAGGTACTATTTCTCTTCCCC
GATGGATCAGGGTCAGCCACGTCTTACTCCGCTCTTCCCAAGCTTGGCAACGACACGGCTGCGTTCGGGCTGAAC
TGCCCATGGATGAAGACACCGGAGCAGATGACAGTCACCCTTGAGGAATTGACAGCAAAGTATCTTCTGGAAGTG
CGTCGACGCCAGCCAAACGGTCCGTACTACCTGGGCGGCTGGTCCGCCGGAGGGATTTGCGCTTACGAAGCTGCG
CGCCAGCTCGCGCAAGACGGTCAGACTACGGCCAAGCTCATCCTTATCGACTCACCCAATCCGATCGGTATGGAA
AATCCTCCCGAGAGGATGTATGATTTCTTCCAGAGAATCGGTCTCTTTGGGACTAGTGGCAAGCCGCCTCCACGT
TGGCTAATCCCACACTTCAATGCTTTTATTCGGTTGCTGGACGCATATCGTATCCAAGCACTGGAAACGTCAATT
GAGACTCACATTGTCTATGCACGCGACGGAATCTGCAAGAATGCTAGCAGCCCTCGGCCGGAGCGACGGCCAGAT
GACCCGCGTGAGATGGTCTGGCTTATTGAGAATCGGACGGACTTTAGTGGGGATGGGTGGGCATCGCTGTTGGGA
AGGGACAACCTCCAGATTGAGGTCCTAAATGAGGTCAATCATTTCTCGATGATGGATCCGGGTGAGCACATGGAG
GCGTTCGAGCGGTTCCTTCGCCGGGCTTTGTTGTAG
Gene >Ani_SJS100_1|g4779.t1
ATGGCCTCTGAACGCCTCTACGCTTTGACAATCTATGGCTATCGCAAGCCAGGTATGCCTGAAGATGAATACCAT
CGCTACCTGAGTGAGCACCATGCCGTTCTGGTGAGGAATCATCTCGTGAAGATGGGTATTGTCAGATACACTCTG
GTAGGTTGGATGTGCCTTATGGAAGGGAGAAGCTGCTGACGTTGCTAGACGCACAACACATCCGAGACAAAGGAG
ATGATGAAGCGTATCTTTGGAGACCTTCCAGAGGGACATACCTCTGATTGTGACTGCTTGGCCCAGATTATGTTT
CGTGATGTGGAGGATTATGTCCGCGCTCGGAATGACCCCCACTATAAGGAGGTTATCTTTCCCGATCATGCCAAC
TTTGCCGACTCAAGTAGAACACTATTTGTGACTGGTTGGGTGGAGTGCCATATTGTGGATGGAGGGATAGTCTAA
AGGCACAGGATCTAGCGCGATAGTGGCGAATGCTCAAGGAAAGTGCTACTATGACCGATATTTAAAATCGGGCAG
CTGGAACCCTCTGATGCAGACTGCGGTTGGCCGTAGACTAGGTGCAATCCAAGTATTGCCTTTCTTGAGGTACTT
TTTTAGCTCTGCAAATGTCATTTGATATTAAGTGTAACTACCCCAAGGAATCATGATATTATGATCTTTGGGCTT
GTCGCTCTATCAGATATTGCATGTGGCGACTGATCAAATAAGTGTGACAATGAAGCAGCCACGGAACATGACCAT
TGCAGTATTCTTCAGCTGTGCAACACATGTACATCAGTTTTGTCTGCCCACTCTTCTAAGTATGGCCATGGCACG
AGGAGAATACGTACCAACTTCGCGTTTCTCAAGAACCCTCCGAGCGTTGACCCGTATCTGCGGCGTCAGCGATGC
CCCTCAAGCGAAAGATCATGGGCCAAGGCCGGACTAGAAGCACATGTTTGAACATCATTCGATCATTACTTGGGC
ATCAGATGCCGGGATATAGATCTTTCTAGGTCACTATTCTCCACAATGTCAGCAGTACTCGGGACCCAACCCTGT
CTCCTCGTGTTATGCTAGGATACCAGCTCCCTGGTTCCGGATGGACAGGCTTTCGATTATTATGAATACATTACA
TCTCCAGATGCCTGTCAGCTCATGGAAGGAAGAATTTCACACCCTCTGATAGGAATAGCTTCCAATTGTATGAAC
ATGGTCATTCGGACAATGCCGGAAGAATCGAACACAAAAACGAATACCTCAGCAACTAGCAAGATGGAGACAGTC
GCCGAGGTATTCCTCTTCGGTGATCAAACGGTAGTGTTTGAGTCGACGCTACACTCGTTGTTGCATGTCAAGGAC
AATGCAGTTCTAACCGACTTCTTTGATCGGGTTGGGTTCCAGTTGCGGCGACACGTTGGGAATCTCCCTTTGCAT
CAGCAGGAATGGTTCCCTTACTTTACTACCCTCATTGATTTGCTTGCCCAGCACGAAAATTGCTATGCGGCTCCG
GCATTAAAGTTGCCCCTGCTATGTGCGACCGAGCTTGGCCAGTTTATTAGGTGAGCTATCAACGTTTTGTTTCCA
CATGTTGATGAATGCATGATTCTAAAGCCTACGCAGGCACTATGGACAAGCAGGGAGAACATATCCTGCACCAGA
AAGTACCTTCCTAATAGGGGCCTGCACAGGAGCCTTTGCTGCTGCTGCAGTTGCAACTTCCCTAACCTTAGCAGA
GCTTGTCCCTGCTGCGGTTGAAGCCGTCACCGTTGCGTTCCGGACGGCGCTGCGATCACTGATCCTACGAAGTGA
TCTTGTACCCACCGTAGAAGAAACTCCGGAACCATGGTCTGCTATTGTAGGTGTCAGTGAGACTGAAGCAACAAG
TGCGATTCAGGGCTTTAACGCCGAGAAGGTGAGTCACGTCCGCAACCAAGGAGAATCCGCAGCTGACAATCACAG
GGGTTGCCTCCCGTATATCGTCTATACCTCAGCTCAGTCAGTCGAACAAATGTTTCGATCAGTGGTCCTCCACAT
CTTCTGGGCCAGTTCCTTTCGTCCTACGCCTGGAAGCACTCGTTCCTTCCGATTGAGCTGCCGTACCACGCGTCG
CATCTTTTCCGGAAGGCCGATGCGGATGTTATCGTGGATGATATCCACGACTCCTCACTGCTAAAGTACACGCTG
CGAACAAAAGTTATTTCCGCTGTTTCCGGTGAAATTATCACAGCGTCTGACCTGCGCAGTCTGCTGCTTCGAGCG
GTTCAGGAAGCCCTCTGTGAGCCCCTCCAGTGGAATCGCATAACTGCATCTCTTTCTCGGGAGTTAAAGCAGGGC
CAATTCACCGACTGTGTAATAAATCAAGTTTCATCACGAAGCGGAACGCTTCTCAGCTCAGCTCTATCACAAGAA
GCGTTTCTCCAAGTTAAAATCGTGCAATCCATAGGGGATGCCTCTGTACACTCTGCTCTCTCGAGCCCAACAGGC
AAATTTTCGCAATCAAGCATTGCCATTATCGGCTTCTCTGGGCGCTTCCCCGAATCTGGCTCTAATGAAGAATTT
TGGGAGATGCTTTTGGCGGGCCGAGATGTACATCGGATTATCCCCGAGGATCGGTTCGACTGGAAGGCCCACTAC
GATCCCACTGGCAAGACCAAGAACACCAGTCGCGTCAAATATGGTTGCTTTATCAAGGAACCTGGAATGTTCGAT
GCTCGCTTCTTCAATATGTCTCCCCGGGAGGCCGAGAACGCAGATCCGGCACAGCGATTGGCCATCACTACAGCA
TATGAGGCAATGGAAATGGCGGGACTGGTGCCAAACACGACACCATCCACCCAGGGAGATCGCATCGGGGTGTTT
TACGGGGTGACGAGTGATGACTGGCGCGAAGTGAATAGCGGGCAGAATGTGGATACGTACTTTATCCCGGGGGGA
AATCGCGCATTCATTCCGGGAAGGATCAGGTATGGCTTTCCACCGATGGCTGGAGTACTAGTATGCTGACAGTTC
AGCTATTTCTTCCGATTCTGTGGCCCCAGCCTGAGTATCGACACAGCATGCTCATCCAGCTGCGCGGCGATTCAA
ACGGCGTGTGCCTACCTATGGCGAGGTGAATGCGACACAGCCCTGGCTGGAGGCGTGAATGTATTGACGAACCCT
GATAACTTCTGTGGACTAGATAGGGGGCATTTCCTGACCGCTAAAGGTTGGTCTGACCTTGTTTATGTGGGAATT
CTAGACTGATGAGACAGGCAATTGCAATGCTTTCGATGATGAAGCAGATGGATACTGCCGATCGGACGCCGTTGG
GACCGTTATTCTCAAACGCCTAGAGGACGCCCTCGAGGATAACGATCCCATATTTGGGGTCATCCGTGGCGCATA
CACCAACCATTGTGGTCGGACAGACTCCATCACTCGACCCTTTGAAGGCGATCAGGCGACTGTATTCAACCGAAT
TATGCGCTATGCTGGAGTTAACCCCCAAGACGTGGGTTACGTCGAAATGCACGGCACTGGAACCCAGGCCGGGGA
TGCCACGGAGATGAAGTCAGTGCTGTCTGTATTTGCGCCTAATATGCGCAGGCAAAATGCTCTGTACTTGGGAAC
AGCAAAAGCTAATATGGGCCATGCCGAGTCTGCTTCGGGTGTTTCGTCTTTGATCAAGGTCCTATTGATGATGCG
GAACGATACGATCCCACCGCATTGTGGTATCAAGACCCGGATAAATCATACCTATCCAATTGACCTGGCACAGCG
AAACGTGCATATTCCATTCAAACCTACACCTTGGCTTCGTGAACAGATGCCCCAACTCAAGCGGACAGTATTCTT
GAATAATTTCAGTGCAGCCGGAGGCAATACTGCCATGCTACTCGAAGATGCCCCAGTTCGAAAAAGTAATAAGGC
CGCGGACCCTCGCTCCAAGCACGTAGTGACAGTGACAGCGAAAACGATCAAATCCCTCAGGGGGAATATCAGCTC
TCTTCTGGCATACTTGGAGCAACATCCGAGTATATCCTTGTCATCTTTATCCTACACCACCACTGCCCGACGTAT
CCACCATAGCTATAGGGTCATAGTGTCAGGTTCTGACACCGGGGAATTTATACACCGGATGCAAGAGATCTTGCC
TGGCTTGGAGAGCCACAGGCCAGTCCCTCCACCGGGAAAGCTCCCAAACATCGTTATGACGTTCAGCGGACAGGG
CACCCTCTCGGTCGGCATGGGAAAGCAGTTCTACGACACGGTGCCCTCGTTTAGGGAGGACGTTACGCGATTCGA
CGACATCGCGAGCCAAATGGGCTTTCCAAGCTTCTTGCCTCTTATTGATGGTAGCATGGTTAACCATCAGGAAGC
AAACCCCACCGTAGCCCACCTGGCCCTGGTCTGCGTTCAGATGGCACTATACAACTACTGGAGGTCTCTAGGGGT
TGTTCCATCGGCAACTATTGGTCACAGCCTCGGCGAATACCCGGCGCTGTATGCTGCTGGTGTCCTTACAGCCTC
GAGTGTAATATATGTGGTGGGCGCTCGGGCTGCCTTGCTATCAGAAAAGACTACCCCACGGACCCATGCTATGTT
GGCAGTAAAAGGGTCCGTTGAGTCTATACAGGGCGAGTTACATAACAGGGGGTGCGCTTTGGCTTGCCTGAACCA
ACCTTTCAGCAATGTTGTGAGCGGAACGGTTGGAGAGTTAATATTGTTGAAGGATTGGCTCACATCTCAGGGCAT
CGGGAGTGTCCAACTGGACATACCGTATGCCTTTCACTCCGTACAAGTGGATCCAATTCTAAACGACTTTAAGAC
GATCTCTGCGGGGGTTGAATACTACGTATCCTCTATTCCTTACATCTCTCCTCTTCTTAGTAGGGTCATCCCTGC
CGGCGAGCCAGATGTTCTTAATGCTTCCTATTTGAGAAACGCATGTCGTGAGCCAGTCAACTTTCAGGGTGCTGT
TGTATCAGCAGAGGAGACTGGTCTAGTTAACGAGAAAACCATATGGTTGGATATCGGCTCGCATCCAGCTTGCTC
AGGCATGATCAAGGGCATATTGGGCACAAAAAGCACCACGATCGCATCGCTTCGAAAAGGGTCAGATTCATGGGC
TGTGCTAACCGCAAGCCTGGAGGTTCTGTACTCCCATGGCATCGATATCCAGTGGGTTGAGTATCATCGCGGGGT
GATTGGTTCTCGGGAGGTACTCCAATTGCCACGGTATGGTTGGGATCTGAAAAACTACTGGATTCCATACAGGAA
CAACTTCTGTCTCTTGAAGGGTGAAGGCCTCATTCCTGCGGAACAGCAAGTAGTGTTGCCACATATGGAGGCTCC
ACGTATTCCCAAGTATATTTCTCCGTCTGTCCAGAGAATTCTCGAGCAAAACGACAGCCCAGAAATGTCAACTCT
TTCGGCCGAGTCAGATATTCACGACGCAAGACTGGCGCCAATACTGGCAGGTCACGTCGTGAATGGCGCAATGTT
ATGTCCATCGGTAAGTAGCTGAATGGCGTTATGTGGTGATATGCTGACAAGGTCCAGTCTCTCTACGCCGATATT
GGCATAACAATCTCAAAGCACATGTTGCAAGCAATTGGAAAATACACCGCGGCAGTCGGATTGGACGTCGCCGAC
ATGCAGGTGCAGAACCCATTGGTTTCCCGGCCTGACACCGAATCGCAGCTCTTCCGTGTGTCTGCGTCGGCGGAC
TGGAGAATCAATGAGATTGCCTTCCGGCTGTATAGTGTCAACCGCACCGGTAGAAAGACTGCCGAGCACGCTGCA
TTTGTCGTACATATTACCGACCAGGTGCAGACCTGGCTGTCTGAATGGAAGCGGCATGCATATTTAGTGCGAAGT
CGGATTGCTTCTCTACATCGGAGCGCGGAAGAAGGCGACGCACACAAACTCAAGCGACGCTTAGCATACCAGTTG
TTCGCCACTCTTGTGCAATATGAAAAAAGCTACCAGGGAATGCAGGAGGTGGTTCTAGACAGCGATAATCATGAA
GCTACTGCCAAGGTGTCTTTTCAAATTGACGAAGACGGCTTCGTGTTCAATCCGTGCTGGATAGACAGTCTTGGG
CATATTGCCGGATTCATCATGAATGCCAGCGATGCCAGTCCTTCTAAAGAGCAGGTCTTTATCAACCATGGCTGG
GAGCGCATGCGATGCGCCGTGCGATTTGTCAACGGCAAGCAGTACCAAGTGTATAACCGCATGCAGCTGGAGACT
GGGACGACCTACGTGGGTGATACATACATCTTTGAGGGCGAGACCGTTGTTGCAGTGTTTCAAGGGATCCGAGTA
TGTAAACAGCTTACTGTAAGAGCGTGTATATGGCTAATGTTTGTAGTTCCAAGGGGTCCCTCGACGACTTCTTGA
CCGACTGCTGCCTCCTAAGATCCCATTTTCTGGCCCCTCTGAGAGGACACAAGAAGTGCGACCAACAACAGCGCC
GATCAATCATCAACCGGTGTGCCGGAGAGCTGGTCCAAAATCTGTACCCCTAGTTCCCGCTCCGAAGCCCAAGGA
GCCAATGGGTTCGTCGAGTGGTATCGCAGCGCGCGTCATGGCCATAATCGCCAAGGAAGCAGGCGTCGATCCATC
AGCCTTGGGACCTAATGAAGAATTCGCCAATTACGGAATTGACTCTCTGCTGTCGCTGACCATCTGCGGTCAGAT
TCAAGAGGAGCTGGACGTTGATGTTCCGTCTTCGTTGTTCGTAGACTATCCCACTCCCAAGGATCTGATCGGCTT
CTTTGGCGTTGAAGATGACTCTTCTCAGCTCACGTCTTCCTTGGAGGGGAGTACTGAGGATGACACATCAAGCTA
TGAAACTGTTGCAACATCAGAGCACGATTCGGAAGTGCCTGTATTGGAGATTCTTCGGACCACGATTGCCCGGGA
AGCGGGCGTACCAACCAATGAGCTGACGCCCTCCACGGCGTTCTCTGATATCGGGGTGGACTCATTGCTTGCCCT
TACCATTGTGAGCACAATAGCAGAGACATACGACATAGCTCTTCCTTCTAATATTTTGATGGAGAAGGAGAACCT
GGAAGAGGTTGGAAAGGCACTTGGTCTGGAAATTAGCCCGAAGACTTCCCTACAGCATACAATGCTCTCTAGGCC
TGCCTTCGATCCATCTGCTGGTCCACAAGCCACATCCATCTTGCTGTGGGGTAAGCCCAAGTCAGCCAAAAAGGT
ACTATTTCTCTTCCCCGATGGATCAGGGTCAGCCACGTCTTACTCCGCTCTTCCCAAGCTTGGCAACGACACGGC
TGCGTTCGGGCTGAACTGCCCATGGATGAAGACACCGGAGCAGATGACAGTCACCCTTGAGGAATTGACAGCAAA
GTATCTTCTGGAAGTGCGTCGACGCCAGCCAAACGGTCCGTACTACCTGGGCGGCTGGTCCGCCGGAGGGATTTG
CGCTTACGAAGCTGCGCGCCAGCTCGCGCAAGACGGTCAGACTACGGCCAAGCTCATCCTTATCGACTCACCCAA
TCCGATCGGTATGGAAAATCCTCCCGAGAGGATGTATGATTTCTTCCAGAGAATCGGTCTCTTTGGGACTAGTGG
CAAGCCGCCTCCACGTTGGCTAATCCCACACTTCAATGCTTTTATTCGGTTGCTGGACGCATATCGTATCCAAGC
ACTGGAAACGTCAATTGAGACTCACATTGTCTATGCACGCGACGGAATCTGCAAGAATGCTAGCAGCCCTCGGCC
GGAGCGACGGCCAGATGACCCGCGTGAGATGGTCTGGCTTATTGAGAATCGGACGGACTTTAGTGGGGATGGGTG
GGCATCGCTGTTGGGAAGGGACAACCTCCAGATTGAGGTCCTAAATGAGGTCAATCATTTCTCGATGATGGATCC
GGGTGAGCACATGGAGGCGTTCGAGCGGTTCCTTCGCCGGGCTTTGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail