Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4734.t1
Gene name
Locationscaffold_024:390765..407261
Strand+
Gene length (bp)16496
Transcript length (bp)16434
Coding sequence length (bp)16434
Protein length (aa) 5478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.9E-70 226 634
PF00501 AMP-binding AMP-binding enzyme 3.5E-68 1785 2182
PF00501 AMP-binding AMP-binding enzyme 3.7E-75 2878 3274
PF00501 AMP-binding AMP-binding enzyme 9.4E-72 3958 4353
PF00668 Condensation Condensation domain 6.1E-12 871 1041
PF00668 Condensation Condensation domain 7.7E-43 1314 1767
PF00668 Condensation Condensation domain 8.8E-36 2439 2854
PF00668 Condensation Condensation domain 1.8E-26 3626 3839
PF00668 Condensation Condensation domain 3.0E-27 4580 5014
PF00668 Condensation Condensation domain 3.6E-43 5049 5434
PF00550 PP-binding Phosphopantetheine attachment site 2.4E-09 789 853
PF00550 PP-binding Phosphopantetheine attachment site 1.4E-11 2327 2391
PF00550 PP-binding Phosphopantetheine attachment site 5.4E-12 3420 3485
PF00550 PP-binding Phosphopantetheine attachment site 5.4E-08 4504 4564

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4734.t1
MFTQATSTTLVENVGVSHRENPDAELAALINAAWSIVVWQYTGQEDTRFITATTSGEADDLESTYQVCNAQLDGA
TTVSDFIQQTHQATKELASDQVPLAPSRNEAATSPFLQSITTLTSNKTYLNSSSPSHLDATGALIELVAIPLPFS
KLEFVVRFAPSTIDQERADHLAAAFAHVLDLIIDPDRRHDRLDAIDLVSNYDKAKLWTWNSVQLPETVESCVHFL
FRQRAQEEPDMLAVDAWDGRFTYGELDAISDRIAVWLAREEGIRPESIVPLCFEKSRWAIAALLGVIKAGGAIVF
IDPANPVSRRQDIMDQIEGKWVLSSKSQAETWENEMGVRTIVLDEQFAASLPVEDHILESGVTPNSLLYLIFTSG
STGKPKGCLIPHKAFISGALVHASLSNLSRGCRVLQLASYSFDVSMLEIMTSLISGACVCTPDMASMAQGLQPIF
DKFDITWAFLTPSLVKLLRPEMVPNLKTLALGGEPLSKVDIETWAPHLQLINGYGPSECSVAAAGDPHLKPTSDP
SNIGRAVGGLCWIVDAENHDRLVPLGAVGELLISGPILARGYLNDAEKTAASFIENPTWTGGWSLTPSDATVSSE
SASMRFYKTGDLARFNLDGTIQILGRKDTQVKLRGLRVELGEIEHNIARHPHIKHAAAFLPKTGRCKEKIVAVVC
LKDFAQDSKAGRSDAPINVLFEDERPDVKDQADAVRNHLRECVPEYMVPAVWIVIEAWPLLVSAKLDRKRVFSWL
LDMDEGLYNRLLGLLGTDESENGSSDEKSDAHLSEVERTLRDIFAHALNTPAHSLPLDKSFIALGGDSLAAMRVI
SQCQRAGLNVTVPDMMKSKCIKDLAARVEKTSGMKTKPDVLDVSFPLSRAQQFCLGDGRAANHLTQSILLKLDST
VSAARVKAALEAIVTRHSMLRARFGESEGNGALSLRQTVTSEIKGSYSFQHHRIERPEDITTIAATADAVSLSGP
IFSAGLVTGAEKQLLVLRAHSAVVDGASWSIIIRQLQTCLSLPDGPLLGEEAQEPVSFQNWVSVERETTGDEIAV
APRILLASEVDMDYQAVELDQATTTLLLSEEVHKPLRTHVVDFMMAGLMLSFRQTFGGRETLPTFALWEDERGRA
SEDFGIDLSQTVGRFETLRALNLDTADMSTNDAQVRMLKGIKDARKTTMEPSSIQNPEISFRYRDLSNIIDGPRS
LVQIKPRPVFLPAPGAAPLVSNISIVAEVIDENIQLAFSFNKKVVQENQVKAWIATAQETLASLVVKMVNAPVEY
TPSDFPLLHGISYNTLDKLINEQLPQIGLIPGPESSLIEDIYPCSPMQQDLLLSQHRSADDMYDVYHIAELRPRD
PRESVSVERLVKSWTEVVQRHTSLRTIFVESSDSEAQFNQVVLARTQPSISIVDCNSPDEDFASVLANQDPISIR
GPEPAHRLSICRIAEASHVVIKLEMNHVIVDGVSAAVIVRDLLQAYDGHAAQLEPAMPFRNYISHIRETPLESSI
DFWADYLRGQSATMVPRLASLETENQGKRQLNVVSVPLKEEGVSNEALLDFCRRASVTPANVFQAAWALVLRAYA
ESPEQVCFGYLSAGRDAPLPGIQEGVGAFLTMLVSRLSFATEEKENEGDKTATVTTLLDAVHIVAEDYVNALPHQ
HVGLSNIQHALKTGGSPLFNTIIAVNRDVDSPADSSLIFKNIGDHEPDEYAIVLDVQLNGSNTARASLRHWTDHL
TAKQAGNIASALGNAVQAIITRPDTPISEVELVGVAHKDQLLSFNTHQLPRANRLIFTNFEKLARVQPHAPAVCA
WDGEWIYSQLDEVSNRLAHYLRTLGVGPEAVVPHCFPKSGWTIVTCLAILKAGGAFVGLDPTHPRKRLEGLVQEA
GAKVVCVAPQNRDLFEGCDNLSIVEITPEFVAKLPSKSGPACGYIQPNNAACVVFTSGTTGRPKAVVVEHASMAT
LSDLMGPAVRIGPEARVFQFASYTFDTSNQDIFTTLQRGGCVCVPSDEDRVNDIPGALNRLRANHAHLTSTVISL
MRPEQVPQLRWLFSAGEPLTRENVEIWAPAVELYNSYGPAESSVAVTCTPTRLSPSGSPANIGQAFGCHAWIADP
TDYHKLMPLGAVGELLLEGPLLARHYLNNPEQTAAAFVQNPRWAKSMSPDQNRRFYRTGDLCRFNRDGSLTIIGR
RDSQIKIHGQRVELDHIKYEVQAQLAQLDQSSLVSVDAVMLPKAQIQDRTLVAFVQFLDEAPAKPLDTLSIPMTE
RLARLFSDLQRALKSSLPQYMVPAMFVPITQIPRTANGKLARNVLREIIAGLSEADVSRYMLQGETAKKAPTTPR
EQKLQAAWSKVLNLPLEKVGASDDFFQLGGDSVVAMRLAGAARVAGMSLTFADIFANPVLSDMAQVVRMGDESRE
QETDEKAFDLVPLSSTSSLQTIRAEAATQCGVRPDAIVDMYPSTPLQEGLVALSMRQTGAYKDQLILRLTDPNYD
VSRFRRAFDAVVSAEPIFRTRFVSVSGAGLLQAVLNVPVDWIKRDNLAAYLEEDLNAPMTYGSALIRLAMVEENG
ERYIVWSGHHALCDGFSMDITFEQIAHAMAHEGSVVPKPVSFKGFIRFLQDQDRDSSAREYWQKQFPADGEAPPQ
FPPRPQGHQVVPHRACRLQFQLNRPAGTKISVTNYLRAAWGLVVARHQDSSDVLFGVTLSGRNAPVAGISTMNGP
TMTTAPFRMTVPLDSETTVAQYLDALHQQAITMMPFEHTGLQNIRRLNELARAAVDNMGHRFAVEPSISDVSEAL
DGMEIVTADLPEGFYTDALVIRNYDHSDGAIVVEARYDHTLISDRDMQRLLSQYNHVVQQLTSQSETCIRDIQVL
SPDDISEIMSWNGDLPETVQGCVHQLVAERAKERPDAEAVCAWDGTYTFEELDGVTERLAAHLQDLGVGPEVTVA
LCFDKSKWNVVSMLSILKAGGCYTALSPAYPAARMQDILQDVQAPLVLCSPHHADKFSGMAPKVLPIDDASFEYL
PKQTTTDRVTSAVQPSNAALIVFTSGSTGKPKGAIIEHRGLCSMQHYEGPHVQMGPDTRTLQFASHVFDVSNSEV
FTTLMRGGCVCVPSETERLSDLAGAVNKYRVNWSFHVPTTAETLDPEQMPGLKHLALGGEAISQGLCDRWASRVT
LLNSYGPSECSIWTSVSHLQPGTLSPNNIGRGLGCRTWITEANDHNRLVAIGCVGELCVEGPIVTRGYKANPEQT
AAAYIENPAFARTLGIQAMRIYKTGDLVKYDADGTILYVGRKDSQVKVRGQRIELSEVEQNIVAHGFDADAVVVE
KVFLDGNKDRVALAAFLRLNSSSESTDASGDVENMDVVRDQLVALKNHLLDTIPPHMVPSFFIPLRSMPVTQTGK
KNRKALRTLGVSLSSEQRQQYTLDDEADSSNTNGGRACTSEAEKRLRALWSEVLGIFPEESISANDNFFHRGGDS
IQAMRLAAAARRAGKALAVSDLFRMPRLYQMAELWESSVQSQDATIAPFSLLQPEIVDDAIQEAVRQCNVDTSDI
EDIYLCSALQEGLMAVSTRKQGSYISTRIFDLPADLDIDRFKEAWQKAADVFPILRTRIILGRASESLQVVLKEK
LAWQTITDETSFSLPVIEYGGRLCSFAIDVEARKFVLALHHALYDGWSATVLLGAVEKFYAGEQYQVGPGYNVFI
RHLSQVDQSESDNFWKGQLSGTPAHFPKLPSKTYEAKNSANVSHTIRLPAPEHQPTGILKSTLLRAAWAIVSSRH
AGSNDITFGAAQSGRDCAVPGIVEVVGPTVTTVPVRIQINDDETIVNFLQRVQEQSVSMIPHQHAGVQTLRQLGK
DVQPALDFTTLFEFGEDSNQSGFITEIEMPELLDGFWSYPIVFECHLAQSGETVNVLARHDPTVIPTHQMDWICK
QFEHVVDQLYRMASDGLEARKVGELDLFGPSDFTQIEAWNARWPVGSIDGKAVHEAIAEQCRLHPQHLALSGWDG
EMTYAQLEHYATKLAKALVLKGVGLEVMVPLCFDKSTWAIVSTIAIIKAGGVVVHLGPTHPANRRKEILKTIGAE
FVLVSPQHTGIFDDAAVTTIPIDREYLDRLPDVDYVELPKVKPSNAVYVCFTSGSTGRPKGIVVEHGNLRMSAQA
HGAQFKVNPGTRVFQFSAYTFDIGLGDIFISLQRGATICTPSEWERLNELPGAITKYRANFMSVTPSVAKLLRPE
AVPTLRTLVLGGEAPTQDNVQTWSDKLNLVIIWGPAETTIYASATPPTTRQTSAQGLGNPMGSVMWLCDPDNHNR
LVPLGCVGEIVVEGPLVSRGYLKDEAKTAAAYIEDPVWARQLDKSASPRRMYKTGDLARYDANGYMLFSGRKDNQ
VKLHGQRMELDEVEHAMLRHERVRQAVARIPRHGPLKDKLVAMLSLHDVSSTSSPVANTIIVLDEASHGIKVGQE
LASVRKLLQQNLPSYMVPTIWIGVEAVPLSANSKVDRKSVDAWMEEMDQETYTSLLRDGGSGEKEEEIRRPSTPV
EQILCNLISKILGLSSETLNLNSSFLALGGDSVAAMQLRSKSRAEGVTVSMLDIIRSKSLVELASKAEYTEPTVK
KVQEGSFDLSPIQQMYFDLVGSAADANIGHFDQSILLEVNSDVAPQTLRQALAQVVRRHSMLRARYARNGTGQWY
QYLAEDSANSFHFSVEDVEDGYQVSRILRNMGGVFDIEKGPVFAARVYNLRSERKQLMFVHAHHLVVDVVSWHVL
LGDLELAIATGSLAGPAPLSFQSWLRSQKDMAQSLEPRELLPFSNTSMPVANFEYWGMGGNKSNRYCDAVVTDFW
LDESLTTQLMSVSKGTSSAAPVDIILASLLHSFAAVFPDRSAPPVFSEGHGRESWNNQVDPSGTVGWFTTMSPLH
VSDLQLDIIKTVQTVKDLRRRLPANGMSYFSSRYLSDKGRKAFGSHFDMEIMFNYLGRSSEVGSENALLSHAELP
DGATFDQLVQDENLPRWSLFDIVALVVGGRTHVTMAYNKHMQHQDRIVEWAAKTKSTLSLAIEVLSGVKSLPLTP
PTTPKPSPLQHQPQDQCITLDSIEGIYPCAPVQRHMLAEREKHPNRRLYEMDFTYQAHALNGVVDVDRIREAWHQ
VVQRHPALRTVFLPSMSSPGSYDQVIIRNWHPEVPFIECASEEEMTARMDAYRSVNYSLSNRKPHHQLTLFSTTV
NGVQKVAFKTETDHTLTDGVSVALILRDLMLAYEGKLPATPAPSFGSYSVWLNGMSQGETLVKDKEYWVEFERSS
GPSLIPHTDASTLVLSQPRVHKTKTINLDLETTSRLPAFCVQHGVTMAAFLQTAWGMVLQHLTGSDKTLFSFMTA
NRDAPFAGAAETVGPLIQMLLCRIDLSNKEIGDVLRQARDDFLESLEHQYGLAQMEDVWQTPAWNSLMSLQYMDS
RVGQKATERTELEVELRSAEDPTAWDVSIGVQIHSRGDGVTEVDAELGYWSDVLTDERAGDVKDLFEASVKKMLD
GC*
Coding >Ani_SJS100_1|g4734.t1
ATGTTTACTCAAGCCACTTCTACTACCCTTGTCGAGAACGTCGGCGTCTCCCATCGCGAGAACCCCGACGCCGAG
CTTGCCGCTCTGATCAACGCTGCCTGGAGCATCGTGGTCTGGCAGTATACCGGCCAGGAAGACACTCGCTTCATC
ACCGCCACTACATCGGGAGAGGCCGACGATCTTGAATCCACCTACCAAGTATGCAACGCACAGCTCGACGGCGCA
ACAACAGTCTCCGACTTCATCCAGCAAACACACCAAGCGACAAAGGAGCTGGCCTCCGACCAGGTCCCTTTGGCC
CCCTCACGAAATGAGGCCGCTACCTCGCCATTCCTGCAATCGATTACGACCCTCACTTCCAACAAGACCTATCTC
AACTCCTCCTCTCCCAGCCATCTGGATGCTACGGGCGCACTAATTGAGCTCGTAGCTATTCCTCTGCCATTTAGC
AAGCTCGAATTCGTGGTGCGTTTTGCGCCATCTACCATCGACCAAGAACGAGCCGATCACCTTGCGGCTGCTTTT
GCGCACGTTCTGGATTTGATCATCGACCCCGACCGGCGTCACGACCGCCTAGATGCCATTGATCTAGTCAGTAAC
TACGATAAGGCAAAGCTTTGGACCTGGAATAGCGTCCAGCTGCCTGAGACGGTCGAATCATGCGTCCATTTCCTC
TTCCGCCAGCGCGCGCAGGAGGAGCCGGACATGCTCGCTGTGGACGCCTGGGACGGCCGCTTCACGTATGGCGAG
CTGGACGCTATTTCCGATCGCATCGCAGTCTGGCTAGCCCGAGAAGAGGGCATCCGACCGGAATCCATTGTACCC
CTGTGCTTTGAGAAGAGCCGCTGGGCCATCGCCGCCCTGTTGGGTGTGATCAAAGCGGGTGGTGCTATTGTGTTT
ATTGACCCAGCTAACCCAGTCAGCCGCAGGCAAGATATCATGGATCAAATCGAAGGTAAGTGGGTACTGAGCTCG
AAAAGCCAGGCCGAAACGTGGGAAAATGAAATGGGCGTGCGAACCATCGTCTTAGACGAACAATTCGCCGCCTCC
CTGCCGGTCGAGGATCATATCCTCGAGTCCGGCGTTACCCCTAACAGCCTCCTCTACCTTATTTTTACTTCCGGA
AGCACAGGTAAGCCGAAAGGCTGTCTCATCCCGCACAAGGCATTCATCTCGGGTGCCCTCGTACACGCCTCTCTA
TCCAATCTCTCCCGCGGTTGTCGTGTCTTGCAGCTCGCCTCGTACAGTTTCGATGTGAGCATGTTGGAGATCATG
ACTTCCCTTATCTCGGGTGCATGTGTATGCACCCCAGACATGGCGAGCATGGCACAGGGTCTCCAGCCCATCTTC
GACAAATTCGACATCACATGGGCCTTCTTGACGCCGTCGCTAGTCAAGCTGCTGCGACCTGAGATGGTTCCCAAC
CTCAAGACGCTCGCCCTAGGTGGTGAGCCACTCAGCAAAGTCGACATCGAGACATGGGCACCACACTTGCAACTA
ATCAACGGATACGGTCCATCCGAGTGTTCCGTCGCCGCGGCGGGCGATCCACATCTAAAACCGACGAGTGATCCA
TCAAATATAGGCCGCGCCGTAGGCGGTCTTTGCTGGATCGTGGATGCCGAAAATCACGACCGGCTCGTCCCCCTT
GGCGCCGTCGGCGAGTTATTAATCTCCGGCCCCATTCTCGCACGGGGATATTTGAATGATGCGGAAAAGACGGCC
GCCTCCTTCATTGAGAACCCGACCTGGACTGGAGGCTGGTCGCTGACACCATCAGACGCGACGGTCTCAAGTGAA
AGCGCATCCATGCGCTTCTACAAGACTGGTGACTTGGCCCGGTTCAACCTTGACGGCACCATCCAGATCCTTGGG
CGCAAAGACACCCAAGTCAAACTCCGTGGATTACGTGTGGAGTTGGGCGAAATTGAGCACAACATCGCTCGCCAC
CCCCACATCAAACATGCTGCAGCGTTCCTCCCCAAGACTGGGCGGTGTAAGGAGAAAATCGTCGCCGTTGTATGT
CTGAAAGACTTCGCTCAGGACTCCAAAGCTGGTCGATCCGATGCGCCCATCAACGTGCTGTTTGAAGATGAGAGG
CCAGATGTTAAGGATCAGGCCGATGCCGTTCGGAACCACCTGCGCGAATGTGTGCCGGAATACATGGTTCCCGCC
GTCTGGATCGTGATCGAGGCATGGCCGCTATTGGTGTCGGCCAAGCTCGATCGCAAGCGGGTCTTTAGCTGGCTG
TTGGACATGGATGAGGGCCTGTATAATCGCCTTTTGGGTTTGCTCGGTACTGACGAGTCAGAAAACGGCTCTTCG
GATGAGAAGTCTGACGCCCATCTGTCCGAGGTCGAACGAACCCTTCGCGACATCTTTGCTCATGCCTTAAATACT
CCCGCTCACAGTTTGCCGCTGGACAAGTCTTTCATTGCGCTTGGTGGCGACAGTCTCGCTGCCATGCGTGTGATC
TCACAATGCCAGCGTGCGGGCTTGAATGTGACAGTCCCGGACATGATGAAGAGTAAATGCATCAAGGACCTGGCT
GCCCGTGTGGAGAAGACATCTGGGATGAAAACAAAGCCAGATGTTTTGGATGTCTCATTTCCACTTTCGCGGGCT
CAGCAGTTCTGCCTGGGTGACGGGAGGGCGGCAAACCATCTCACGCAGAGCATTCTTCTGAAACTGGATAGCACT
GTTTCGGCCGCTCGTGTCAAGGCTGCGTTGGAAGCCATTGTCACCCGCCACTCCATGTTGCGGGCGCGCTTTGGT
GAATCAGAAGGAAATGGCGCCCTGTCTCTCAGACAGACAGTCACCTCTGAGATCAAGGGTTCTTACAGCTTTCAG
CATCACCGCATAGAACGTCCTGAAGATATCACCACCATCGCAGCCACAGCAGACGCCGTGTCCCTCTCTGGACCG
ATCTTCTCCGCTGGTCTGGTTACAGGAGCGGAAAAGCAGCTGTTGGTCTTGAGAGCCCACAGTGCTGTGGTCGAC
GGCGCCTCCTGGAGCATCATCATCCGGCAGCTCCAGACCTGCTTGAGTCTTCCCGATGGGCCTCTTCTGGGCGAA
GAAGCCCAGGAGCCAGTCTCTTTCCAGAACTGGGTTAGTGTCGAGAGAGAGACAACGGGTGACGAGATTGCAGTC
GCGCCACGCATTCTGCTAGCATCGGAGGTTGACATGGACTACCAGGCAGTGGAGCTTGACCAGGCAACAACTACT
CTGCTCTTGAGCGAGGAAGTACACAAGCCACTGCGGACTCACGTCGTCGACTTCATGATGGCAGGTCTGATGCTT
TCATTTAGGCAAACATTTGGCGGCCGGGAGACCCTACCTACATTTGCTTTGTGGGAGGATGAGCGTGGACGCGCG
TCTGAAGATTTTGGCATTGACCTCTCGCAAACCGTTGGTCGATTCGAGACTCTGCGTGCATTGAATCTCGACACG
GCCGATATGAGCACCAACGACGCGCAAGTGCGCATGTTGAAGGGGATCAAGGACGCCCGGAAAACGACAATGGAG
CCAAGCAGTATTCAGAACCCGGAGATCTCGTTTCGCTACCGTGATCTGTCGAACATTATTGACGGTCCTCGCAGC
CTTGTGCAAATCAAACCGCGTCCCGTCTTTCTCCCTGCGCCCGGAGCAGCTCCTTTGGTTAGCAACATCTCCATT
GTGGCGGAAGTCATCGATGAGAATATTCAGCTTGCCTTCTCTTTTAACAAGAAGGTTGTTCAAGAGAACCAGGTC
AAGGCGTGGATTGCGACCGCGCAGGAAACGCTTGCTTCCCTTGTTGTCAAGATGGTCAACGCCCCGGTTGAATAC
ACCCCATCAGACTTCCCGTTATTGCACGGAATCAGCTACAACACCCTGGACAAGCTCATCAACGAACAACTGCCC
CAGATCGGCCTTATTCCTGGGCCTGAGTCTTCGTTGATCGAAGACATTTATCCATGCTCACCCATGCAGCAGGAC
CTGTTGCTTAGCCAGCACCGGTCCGCGGATGACATGTATGATGTCTACCATATCGCGGAACTGAGGCCACGCGAT
CCCAGGGAGTCGGTGTCTGTTGAGCGACTTGTGAAGTCGTGGACAGAGGTCGTGCAGCGACACACGTCTCTCCGG
ACAATCTTCGTTGAAAGCTCCGACAGTGAGGCACAGTTCAACCAGGTCGTGCTGGCCCGTACCCAGCCTAGCATC
TCCATCGTGGACTGCAATAGCCCTGACGAAGATTTCGCGTCCGTCCTTGCCAACCAAGACCCCATCTCGATCAGA
GGACCCGAGCCTGCGCATCGGTTGTCTATCTGCCGCATTGCAGAAGCCAGTCACGTTGTCATCAAACTAGAGATG
AACCATGTCATCGTGGATGGCGTCTCTGCGGCTGTGATTGTCCGTGATCTACTGCAGGCGTATGATGGGCATGCG
GCGCAATTGGAGCCTGCAATGCCGTTCCGCAACTACATCTCCCACATCCGCGAGACGCCTCTGGAATCATCAATC
GACTTTTGGGCAGATTACCTCAGGGGTCAGAGTGCGACCATGGTTCCCAGGCTGGCCAGCCTAGAGACTGAGAAC
CAAGGTAAGAGACAGTTGAACGTGGTGTCAGTTCCCCTGAAAGAGGAGGGCGTCTCAAATGAGGCGCTTCTCGAC
TTCTGCCGGAGGGCCTCCGTCACCCCTGCCAATGTGTTTCAGGCTGCCTGGGCACTGGTACTCCGGGCTTATGCC
GAGTCGCCCGAGCAAGTCTGCTTCGGTTACCTCTCGGCAGGACGCGACGCTCCCCTCCCAGGCATCCAAGAAGGA
GTCGGTGCTTTCCTCACTATGCTGGTGAGCCGTCTGTCTTTTGCAACCGAGGAGAAGGAGAACGAAGGTGATAAG
ACTGCCACCGTTACTACATTGCTGGACGCAGTGCACATTGTTGCCGAAGACTACGTCAACGCCCTGCCTCACCAG
CACGTTGGTCTCTCCAACATCCAGCACGCACTCAAGACAGGAGGCAGTCCACTCTTCAATACCATCATTGCAGTA
AACCGTGATGTTGACAGCCCAGCCGATTCGTCACTCATCTTCAAGAACATCGGGGATCACGAACCCGATGAGTAC
GCCATCGTCCTAGACGTACAGCTCAACGGCTCTAACACGGCGCGTGCTTCACTCCGTCACTGGACCGATCACTTG
ACGGCCAAGCAAGCAGGCAATATTGCGAGTGCGCTCGGTAATGCCGTTCAAGCAATTATAACCCGGCCGGATACC
CCTATCAGCGAGGTCGAACTTGTGGGCGTCGCCCATAAGGATCAATTGTTGTCCTTCAACACCCACCAACTGCCA
CGGGCAAACCGATTGATCTTCACGAATTTCGAGAAGCTCGCCCGCGTGCAGCCTCACGCTCCGGCGGTGTGTGCT
TGGGATGGCGAGTGGATATACAGCCAACTCGATGAGGTATCCAACCGCCTCGCTCACTACCTGCGTACCTTAGGG
GTAGGTCCCGAGGCCGTTGTGCCACACTGTTTCCCGAAGTCGGGTTGGACCATCGTGACGTGCCTTGCGATTCTG
AAAGCCGGTGGTGCCTTCGTCGGGCTGGATCCGACCCATCCAAGAAAGCGACTGGAGGGTTTGGTCCAAGAAGCC
GGAGCGAAGGTGGTGTGTGTGGCACCGCAGAATCGGGACTTGTTCGAAGGGTGCGACAACTTGAGCATTGTGGAG
ATCACGCCAGAGTTCGTTGCTAAGCTCCCTTCAAAGTCTGGCCCGGCATGCGGCTACATCCAGCCAAACAATGCG
GCTTGCGTCGTTTTCACGTCTGGTACGACCGGTCGGCCCAAGGCTGTAGTGGTGGAACATGCCTCGATGGCGACC
CTGTCAGATCTCATGGGTCCGGCGGTTCGTATCGGTCCAGAGGCTCGCGTCTTCCAGTTCGCCAGTTACACCTTT
GATACATCGAATCAGGACATTTTCACCACCCTCCAGCGCGGTGGCTGCGTTTGCGTGCCGTCAGATGAGGACCGT
GTCAACGATATCCCTGGAGCATTGAACCGCCTTCGCGCTAACCACGCCCACTTGACCAGCACTGTTATTAGTCTC
ATGCGCCCGGAGCAGGTCCCCCAGCTCCGATGGCTGTTTAGCGCTGGCGAGCCCCTTACCCGGGAGAACGTGGAG
ATCTGGGCGCCAGCAGTCGAGCTTTACAACAGTTATGGCCCGGCCGAGTCATCTGTCGCCGTCACTTGTACTCCC
ACCCGTCTGAGCCCGAGTGGCAGCCCAGCAAACATCGGTCAGGCCTTTGGTTGCCACGCATGGATCGCGGATCCC
ACCGACTACCACAAGCTGATGCCTCTGGGTGCCGTGGGAGAGCTCCTTCTTGAGGGTCCGCTGCTCGCGCGTCAC
TACCTGAACAACCCAGAACAGACAGCAGCAGCCTTTGTCCAGAACCCCCGATGGGCGAAGAGTATGAGTCCGGAC
CAGAACCGGCGATTCTACCGAACCGGCGATCTGTGTCGCTTCAACCGTGACGGCAGTCTGACCATCATCGGCCGC
CGTGATAGCCAGATCAAGATTCACGGCCAGCGCGTTGAGCTTGACCACATCAAGTACGAAGTTCAGGCCCAGCTC
GCCCAGCTTGATCAATCGAGTCTGGTTTCCGTTGATGCTGTGATGCTTCCAAAGGCCCAAATCCAGGACCGAACT
TTGGTAGCATTCGTTCAGTTTCTCGACGAGGCGCCTGCGAAGCCCCTGGACACTTTGTCCATTCCCATGACTGAG
AGGCTCGCCCGCCTGTTCTCCGACCTGCAGCGAGCCCTCAAGTCAAGCCTACCTCAATACATGGTCCCGGCCATG
TTCGTCCCAATCACGCAGATTCCACGAACCGCGAACGGCAAGCTGGCTCGTAATGTCCTGCGGGAGATAATCGCT
GGTCTTTCCGAGGCCGACGTTTCTCGTTACATGCTGCAGGGTGAGACCGCGAAGAAAGCCCCGACGACACCCCGT
GAGCAGAAGCTTCAAGCCGCCTGGAGTAAAGTCCTGAACTTGCCCTTGGAGAAGGTGGGCGCTTCTGATGACTTC
TTCCAACTTGGAGGCGACTCAGTTGTGGCCATGCGGCTTGCAGGCGCTGCACGAGTGGCAGGCATGTCCTTGACT
TTCGCGGACATCTTCGCGAATCCCGTCTTGTCCGACATGGCTCAAGTTGTACGAATGGGCGATGAATCTAGAGAA
CAGGAGACAGATGAGAAAGCATTTGACCTTGTCCCACTGTCATCCACGTCATCACTGCAGACGATTCGCGCCGAA
GCGGCAACACAGTGTGGTGTCAGGCCTGATGCCATCGTTGATATGTACCCATCCACCCCACTACAGGAGGGTCTG
GTCGCTCTTTCGATGCGACAAACCGGAGCGTACAAGGATCAACTCATCCTGCGCCTCACAGACCCAAATTACGAC
GTGTCCAGATTCCGCCGTGCGTTCGATGCCGTTGTCTCCGCCGAGCCTATTTTCCGAACGCGCTTTGTGAGCGTC
AGTGGCGCCGGACTCCTCCAGGCGGTACTGAATGTCCCGGTTGACTGGATCAAGCGCGACAATCTGGCCGCGTAT
CTCGAGGAGGATTTAAACGCTCCGATGACCTATGGAAGTGCGCTCATCCGTCTCGCCATGGTAGAGGAGAACGGA
GAACGTTACATCGTGTGGTCAGGACACCATGCACTGTGCGACGGCTTCAGCATGGACATCACATTCGAACAGATT
GCCCACGCGATGGCACACGAGGGTTCCGTGGTCCCCAAGCCGGTCTCCTTCAAGGGATTCATCCGCTTCTTGCAG
GATCAGGATCGAGACAGCTCTGCCAGGGAGTACTGGCAGAAGCAGTTCCCTGCTGACGGCGAGGCACCGCCCCAA
TTTCCACCCAGGCCACAAGGCCACCAGGTTGTCCCTCATCGTGCTTGTCGCCTACAATTCCAGCTGAATCGCCCG
GCTGGTACCAAGATCTCAGTGACGAACTATCTGCGCGCCGCATGGGGTCTCGTCGTGGCTCGACACCAGGACAGC
TCGGACGTCCTGTTCGGCGTGACCCTTTCTGGCCGAAACGCCCCGGTTGCAGGTATCTCTACCATGAACGGGCCC
ACGATGACAACCGCCCCGTTCCGTATGACCGTTCCGTTGGATAGCGAGACAACGGTAGCTCAGTACCTGGACGCC
CTCCACCAACAGGCCATTACAATGATGCCGTTTGAACACACCGGTCTGCAGAATATTCGTCGTCTCAATGAGCTG
GCCCGTGCGGCTGTAGACAATATGGGACATCGTTTTGCGGTGGAGCCGAGCATCAGCGACGTCAGTGAGGCCCTT
GACGGCATGGAAATTGTAACCGCCGATCTTCCAGAGGGCTTTTACACCGATGCCTTGGTCATCCGCAACTATGAC
CACAGTGATGGAGCAATCGTCGTGGAAGCTCGCTATGATCACACTTTAATATCTGACCGCGATATGCAGAGACTG
CTTAGCCAATACAATCATGTTGTCCAGCAACTGACCAGTCAATCAGAGACGTGCATTCGTGATATCCAAGTGCTT
AGCCCCGACGACATCAGTGAGATCATGTCATGGAATGGTGATCTACCTGAAACAGTACAAGGGTGCGTGCATCAA
CTTGTCGCAGAGCGAGCGAAGGAGCGTCCAGACGCTGAGGCCGTGTGTGCCTGGGACGGAACTTACACCTTCGAA
GAACTGGATGGGGTGACCGAACGCCTTGCAGCCCATCTTCAGGACCTCGGCGTCGGCCCAGAAGTGACGGTCGCT
CTTTGCTTTGACAAGTCCAAATGGAATGTCGTCTCTATGTTATCCATCCTGAAGGCTGGCGGTTGCTACACGGCC
TTGAGTCCGGCATACCCAGCCGCTCGCATGCAGGATATCCTCCAGGATGTCCAAGCACCCCTGGTACTGTGCTCA
CCCCATCATGCAGATAAGTTCTCTGGCATGGCGCCCAAGGTTCTGCCAATCGATGATGCCAGTTTCGAATACCTA
CCCAAACAAACAACAACCGACCGCGTCACCTCCGCAGTGCAACCATCCAATGCAGCACTGATCGTTTTCACCTCC
GGCAGTACGGGTAAGCCCAAGGGCGCAATCATTGAACATCGTGGTTTGTGTTCCATGCAACACTATGAAGGACCT
CATGTACAAATGGGACCGGATACTCGCACACTACAATTCGCCTCCCATGTCTTCGACGTGTCCAACTCGGAGGTT
TTTACCACCTTGATGCGGGGTGGCTGTGTGTGTGTGCCGTCTGAGACCGAGCGACTTAGCGACCTCGCTGGCGCA
GTTAACAAGTACAGAGTGAACTGGTCCTTCCACGTTCCAACAACTGCAGAGACACTCGATCCGGAGCAGATGCCA
GGCTTGAAGCATCTGGCTTTGGGCGGTGAAGCCATCAGTCAAGGCCTGTGTGACCGCTGGGCATCTCGTGTGACA
CTACTCAATTCATATGGACCCTCGGAGTGCAGTATCTGGACGAGTGTCTCGCATCTGCAGCCAGGGACTTTGTCT
CCGAACAACATCGGTCGCGGACTTGGCTGCCGGACATGGATCACCGAAGCAAATGACCACAATCGTCTGGTGGCG
ATTGGGTGCGTGGGTGAACTCTGTGTTGAAGGCCCAATCGTCACACGAGGTTATAAAGCCAATCCCGAACAGACC
GCTGCTGCCTACATCGAGAACCCAGCATTTGCGCGGACTCTGGGCATCCAAGCCATGCGCATCTACAAGACAGGT
GACTTGGTAAAGTATGATGCAGACGGCACTATCCTCTATGTCGGCCGTAAGGATAGCCAAGTCAAGGTCCGTGGA
CAGCGCATTGAGCTGAGCGAGGTGGAACAAAACATCGTGGCCCACGGCTTTGATGCAGACGCTGTCGTTGTCGAA
AAGGTCTTCTTGGATGGGAACAAAGACCGCGTGGCTCTGGCGGCCTTCCTAAGACTCAATTCATCCTCTGAGTCA
ACTGATGCATCTGGGGATGTCGAAAACATGGACGTCGTTCGAGACCAGCTCGTCGCCCTCAAGAACCACTTATTG
GACACCATTCCTCCTCACATGGTCCCCTCTTTCTTTATTCCTCTACGATCCATGCCTGTGACACAGACGGGAAAG
AAGAACCGCAAGGCGCTCAGAACACTCGGTGTATCTTTGTCGTCCGAGCAAAGACAACAGTACACTCTCGACGAT
GAAGCCGATTCATCAAACACCAACGGAGGTCGCGCATGCACAAGCGAAGCTGAGAAGCGGCTCCGAGCATTGTGG
TCTGAAGTCCTCGGAATCTTCCCAGAGGAGTCAATCTCGGCCAACGATAATTTCTTCCACAGAGGAGGTGATTCG
ATTCAAGCGATGCGACTGGCGGCTGCGGCTCGTCGCGCTGGCAAAGCGCTGGCAGTGAGCGACTTGTTCCGCATG
CCGCGGCTGTACCAAATGGCCGAGCTCTGGGAGAGCAGTGTGCAAAGCCAAGACGCAACCATTGCGCCTTTCTCG
CTGCTCCAGCCAGAGATCGTTGACGACGCTATTCAGGAGGCCGTTCGCCAATGTAATGTCGATACGAGCGACATC
GAAGACATTTATCTCTGTTCGGCACTGCAGGAAGGTCTCATGGCAGTCTCCACTCGGAAGCAGGGCTCCTACATC
TCGACAAGAATCTTCGACTTGCCAGCTGATCTCGACATTGATCGCTTCAAGGAAGCATGGCAAAAGGCCGCCGAC
GTCTTCCCGATCTTGCGGACGCGCATTATCCTCGGTCGTGCCTCCGAGTCTCTCCAGGTCGTGCTCAAGGAAAAG
CTAGCATGGCAGACCATCACCGATGAGACATCCTTTAGCCTTCCCGTCATTGAGTACGGAGGCCGTCTGTGCTCC
TTTGCGATCGACGTCGAGGCACGCAAATTTGTCTTGGCCCTCCATCACGCTCTTTATGATGGCTGGAGTGCCACG
GTACTGCTTGGGGCTGTGGAAAAGTTCTACGCGGGTGAGCAATACCAGGTGGGTCCAGGATATAATGTCTTCATT
CGGCATCTCTCTCAAGTTGATCAATCCGAGTCGGACAATTTCTGGAAAGGTCAGCTCAGTGGTACACCCGCACAT
TTCCCCAAGTTGCCCTCCAAAACATACGAGGCCAAGAACAGCGCCAACGTCTCTCACACCATCCGTCTACCAGCG
CCCGAGCATCAACCCACTGGAATACTCAAGTCAACCTTGCTCCGAGCAGCATGGGCCATCGTGAGTTCCAGGCAT
GCCGGGTCCAATGATATCACCTTTGGTGCAGCCCAATCAGGTCGCGACTGCGCTGTCCCTGGCATCGTGGAAGTT
GTCGGCCCAACTGTTACGACGGTACCGGTTCGCATCCAGATCAATGACGACGAGACCATCGTCAACTTCCTCCAG
CGGGTTCAAGAGCAATCTGTCAGCATGATCCCGCACCAGCATGCCGGTGTGCAAACACTTCGACAGCTGGGCAAA
GACGTCCAACCCGCGCTCGACTTCACCACTTTGTTCGAGTTCGGAGAGGATTCCAACCAGAGTGGCTTCATCACT
GAGATAGAAATGCCTGAGCTGCTGGACGGTTTCTGGTCCTATCCTATTGTCTTCGAGTGCCATCTGGCTCAGAGC
GGGGAGACTGTCAACGTTTTGGCACGACATGACCCGACGGTCATTCCCACACACCAGATGGATTGGATCTGCAAG
CAGTTCGAACACGTCGTCGACCAGCTCTACCGTATGGCATCTGATGGGCTCGAGGCTAGAAAGGTTGGTGAGCTC
GACCTCTTCGGCCCAAGTGACTTTACCCAAATCGAGGCCTGGAATGCTAGATGGCCTGTGGGTTCCATAGACGGC
AAGGCAGTTCACGAGGCCATTGCCGAGCAATGCCGACTTCATCCCCAGCACCTCGCCCTCTCAGGCTGGGATGGC
GAAATGACCTACGCGCAGCTAGAGCACTACGCGACAAAGCTAGCCAAGGCACTTGTTCTAAAGGGTGTTGGACTC
GAAGTCATGGTTCCACTCTGCTTTGACAAGTCCACCTGGGCCATCGTGTCTACCATAGCAATCATCAAAGCCGGA
GGCGTCGTTGTGCATCTTGGGCCTACTCACCCGGCGAACCGCAGAAAGGAGATCTTGAAGACGATCGGAGCCGAG
TTTGTATTGGTCTCGCCGCAACACACTGGCATCTTTGATGATGCCGCTGTCACAACCATCCCGATTGACCGAGAG
TATTTGGATCGACTGCCCGATGTTGACTACGTGGAGCTGCCCAAGGTCAAGCCCTCCAACGCAGTCTATGTTTGC
TTCACTTCAGGAAGCACAGGTCGGCCCAAGGGAATTGTGGTCGAACACGGCAATCTGCGCATGAGCGCACAGGCA
CACGGTGCTCAATTTAAGGTCAACCCTGGCACCAGGGTGTTCCAGTTCTCGGCTTATACTTTCGATATCGGTCTC
GGTGACATATTCATTTCCCTCCAACGCGGAGCCACCATCTGCACGCCATCTGAATGGGAGAGATTGAACGAGCTT
CCTGGAGCCATCACCAAATATCGGGCGAACTTTATGTCGGTCACCCCATCGGTGGCCAAACTTCTCCGCCCAGAG
GCCGTTCCAACACTGCGCACCCTTGTCCTCGGTGGTGAAGCACCCACTCAAGACAATGTGCAAACCTGGTCCGAT
AAACTGAACCTAGTTATCATTTGGGGACCAGCCGAGACCACCATCTACGCATCGGCTACCCCGCCCACGACCCGG
CAAACAAGTGCACAGGGCCTCGGAAACCCAATGGGTAGTGTAATGTGGCTGTGCGATCCAGACAACCACAACAGG
CTGGTGCCCCTTGGTTGCGTGGGTGAGATTGTTGTCGAGGGCCCGCTTGTCTCGCGTGGCTATCTCAAGGACGAG
GCAAAGACGGCAGCTGCGTATATCGAGGATCCAGTTTGGGCTAGGCAGCTGGACAAGAGTGCCTCGCCTCGCCGG
ATGTACAAAACTGGAGATTTGGCACGCTACGACGCCAACGGATATATGTTATTCTCCGGTCGTAAAGACAATCAG
GTGAAGCTCCACGGACAAAGAATGGAGCTGGACGAAGTGGAACACGCCATGTTAAGACACGAAAGAGTGCGCCAG
GCTGTCGCGCGTATCCCTCGGCACGGACCACTCAAAGACAAGCTGGTGGCGATGTTGAGTCTCCATGATGTCTCA
TCGACCAGCTCCCCCGTTGCAAACACAATTATTGTGCTTGATGAAGCCTCCCATGGTATTAAGGTTGGACAGGAA
CTTGCCTCCGTGCGTAAGTTGCTGCAACAAAACCTACCAAGCTACATGGTACCAACGATTTGGATTGGTGTCGAG
GCTGTTCCGCTGAGCGCCAATTCGAAGGTTGATCGGAAATCCGTTGATGCTTGGATGGAAGAGATGGATCAGGAA
ACCTATACCTCGTTGCTGCGCGATGGAGGTAGTGGTGAGAAAGAAGAAGAAATTCGCCGCCCATCCACCCCGGTG
GAACAAATTCTGTGCAACCTCATCAGCAAGATTCTTGGCTTGAGCTCGGAGACACTCAACCTCAACTCTTCGTTC
CTGGCCCTTGGTGGCGACTCCGTAGCTGCAATGCAGCTGCGTAGCAAGTCTCGCGCTGAGGGGGTTACGGTCTCC
ATGCTGGACATTATCAGGAGCAAGAGTCTCGTCGAGCTTGCGTCGAAGGCGGAATATACCGAACCAACTGTGAAG
AAGGTCCAGGAAGGGTCCTTTGATCTCTCGCCAATCCAGCAGATGTACTTCGATCTGGTGGGATCTGCTGCAGAC
GCAAACATTGGTCATTTCGACCAGAGCATTCTTCTGGAAGTCAACAGCGACGTGGCGCCTCAAACGTTGCGACAG
GCCCTCGCACAGGTTGTTCGGCGGCACTCGATGCTCCGCGCCCGATATGCTCGAAATGGTACCGGCCAGTGGTAT
CAGTACCTTGCTGAAGATTCAGCAAATTCATTCCATTTCAGCGTCGAAGACGTGGAAGATGGTTATCAAGTGTCC
AGAATACTGAGGAACATGGGTGGTGTGTTTGACATCGAGAAAGGCCCAGTCTTCGCTGCCCGCGTATACAATCTT
CGTTCAGAGCGCAAACAGTTGATGTTTGTTCATGCTCATCATTTGGTGGTGGATGTGGTTTCGTGGCACGTTCTG
CTGGGCGATCTAGAGCTTGCCATTGCCACTGGCAGCTTGGCCGGCCCAGCTCCGCTCTCTTTCCAGAGTTGGTTG
CGTTCTCAAAAGGACATGGCGCAGTCTCTTGAACCACGAGAGCTGCTACCTTTCTCAAACACAAGCATGCCTGTG
GCCAACTTTGAATATTGGGGAATGGGAGGCAACAAGTCCAACAGATACTGCGACGCCGTCGTGACCGACTTTTGG
CTCGATGAGTCCCTAACTACCCAGTTAATGAGTGTCAGCAAGGGTACTTCAAGCGCTGCCCCTGTCGACATCATT
CTGGCTTCTCTTCTCCACTCCTTTGCGGCCGTCTTCCCTGACCGTTCCGCACCACCAGTCTTCTCTGAGGGCCAT
GGTCGCGAGTCATGGAACAACCAGGTCGATCCTTCCGGCACAGTGGGTTGGTTTACAACTATGAGCCCACTGCAT
GTATCTGATCTGCAATTGGATATTATCAAGACCGTGCAGACCGTAAAGGATCTCCGTCGCCGGCTACCAGCTAAC
GGCATGTCATATTTCAGCTCCAGGTATCTCTCCGACAAAGGGCGCAAAGCCTTTGGTTCTCATTTCGATATGGAG
ATCATGTTCAACTACCTTGGCCGGTCCTCTGAAGTTGGAAGTGAGAACGCCCTTCTCTCGCATGCCGAACTACCA
GACGGCGCGACCTTCGACCAATTGGTCCAAGATGAAAACCTTCCCCGCTGGTCTCTCTTCGACATCGTTGCCCTT
GTCGTTGGCGGCAGAACCCACGTTACCATGGCCTATAACAAGCACATGCAACACCAGGATAGAATCGTTGAGTGG
GCAGCCAAGACAAAGTCCACTCTGAGCCTTGCCATTGAGGTTCTCAGTGGGGTGAAAAGCCTGCCGCTCACTCCG
CCAACCACTCCCAAACCCTCACCCTTGCAGCACCAGCCCCAGGATCAATGCATCACCCTCGACAGCATTGAAGGA
ATTTACCCCTGTGCCCCAGTACAGCGACACATGCTCGCAGAGCGCGAAAAGCACCCCAACCGCCGCTTGTACGAG
ATGGATTTTACTTACCAAGCTCATGCACTCAATGGTGTCGTCGACGTGGATAGAATCCGCGAAGCATGGCACCAG
GTTGTGCAACGCCATCCCGCACTTCGAACTGTCTTCCTTCCCAGCATGTCTTCGCCCGGCTCCTACGACCAAGTT
ATCATTCGGAACTGGCACCCCGAGGTCCCCTTTATCGAGTGCGCCAGTGAGGAGGAGATGACGGCTCGCATGGAC
GCCTACCGATCGGTCAACTACAGCCTCTCGAATAGAAAGCCACACCATCAGCTCACCTTGTTCAGTACAACAGTC
AATGGCGTGCAAAAGGTTGCCTTCAAAACTGAAACAGACCACACCCTTACCGACGGCGTTTCTGTCGCTCTGATC
CTCCGCGACCTGATGCTGGCGTATGAGGGCAAACTTCCCGCCACCCCAGCCCCGTCATTCGGTAGCTATTCTGTC
TGGCTGAACGGGATGAGCCAAGGCGAGACACTAGTTAAGGACAAGGAATACTGGGTGGAGTTCGAGCGGAGCTCA
GGGCCATCACTTATTCCTCATACCGATGCCTCCACCCTTGTACTATCCCAACCCCGGGTCCACAAAACAAAGACC
ATCAACCTGGATTTGGAAACCACCAGCCGACTTCCTGCCTTCTGCGTGCAGCACGGTGTCACTATGGCGGCGTTC
CTCCAGACGGCCTGGGGAATGGTGTTACAGCACCTCACGGGATCTGACAAGACGCTCTTCTCCTTCATGACCGCC
AACAGGGATGCGCCGTTCGCCGGCGCAGCAGAGACCGTCGGTCCGCTCATCCAAATGCTTCTGTGTCGGATCGAT
CTCAGCAACAAGGAGATTGGCGACGTGTTGAGGCAAGCACGAGATGACTTCCTTGAGTCGCTGGAGCATCAGTAC
GGACTGGCCCAGATGGAAGACGTGTGGCAGACCCCAGCGTGGAATTCTCTTATGAGTCTACAGTACATGGACTCG
CGAGTGGGTCAGAAGGCCACGGAGCGGACTGAACTGGAGGTTGAGCTGCGTTCGGCAGAAGATCCCACTGCGTGG
GACGTGTCGATCGGTGTGCAGATCCATAGTCGGGGAGACGGTGTTACTGAAGTGGATGCGGAGCTTGGCTATTGG
TCTGATGTGCTCACGGATGAGCGGGCAGGAGATGTGAAGGATTTGTTTGAAGCATCTGTGAAGAAGATGCTTGAT
GGATGTTGA
Transcript >Ani_SJS100_1|g4734.t1
ATGTTTACTCAAGCCACTTCTACTACCCTTGTCGAGAACGTCGGCGTCTCCCATCGCGAGAACCCCGACGCCGAG
CTTGCCGCTCTGATCAACGCTGCCTGGAGCATCGTGGTCTGGCAGTATACCGGCCAGGAAGACACTCGCTTCATC
ACCGCCACTACATCGGGAGAGGCCGACGATCTTGAATCCACCTACCAAGTATGCAACGCACAGCTCGACGGCGCA
ACAACAGTCTCCGACTTCATCCAGCAAACACACCAAGCGACAAAGGAGCTGGCCTCCGACCAGGTCCCTTTGGCC
CCCTCACGAAATGAGGCCGCTACCTCGCCATTCCTGCAATCGATTACGACCCTCACTTCCAACAAGACCTATCTC
AACTCCTCCTCTCCCAGCCATCTGGATGCTACGGGCGCACTAATTGAGCTCGTAGCTATTCCTCTGCCATTTAGC
AAGCTCGAATTCGTGGTGCGTTTTGCGCCATCTACCATCGACCAAGAACGAGCCGATCACCTTGCGGCTGCTTTT
GCGCACGTTCTGGATTTGATCATCGACCCCGACCGGCGTCACGACCGCCTAGATGCCATTGATCTAGTCAGTAAC
TACGATAAGGCAAAGCTTTGGACCTGGAATAGCGTCCAGCTGCCTGAGACGGTCGAATCATGCGTCCATTTCCTC
TTCCGCCAGCGCGCGCAGGAGGAGCCGGACATGCTCGCTGTGGACGCCTGGGACGGCCGCTTCACGTATGGCGAG
CTGGACGCTATTTCCGATCGCATCGCAGTCTGGCTAGCCCGAGAAGAGGGCATCCGACCGGAATCCATTGTACCC
CTGTGCTTTGAGAAGAGCCGCTGGGCCATCGCCGCCCTGTTGGGTGTGATCAAAGCGGGTGGTGCTATTGTGTTT
ATTGACCCAGCTAACCCAGTCAGCCGCAGGCAAGATATCATGGATCAAATCGAAGGTAAGTGGGTACTGAGCTCG
AAAAGCCAGGCCGAAACGTGGGAAAATGAAATGGGCGTGCGAACCATCGTCTTAGACGAACAATTCGCCGCCTCC
CTGCCGGTCGAGGATCATATCCTCGAGTCCGGCGTTACCCCTAACAGCCTCCTCTACCTTATTTTTACTTCCGGA
AGCACAGGTAAGCCGAAAGGCTGTCTCATCCCGCACAAGGCATTCATCTCGGGTGCCCTCGTACACGCCTCTCTA
TCCAATCTCTCCCGCGGTTGTCGTGTCTTGCAGCTCGCCTCGTACAGTTTCGATGTGAGCATGTTGGAGATCATG
ACTTCCCTTATCTCGGGTGCATGTGTATGCACCCCAGACATGGCGAGCATGGCACAGGGTCTCCAGCCCATCTTC
GACAAATTCGACATCACATGGGCCTTCTTGACGCCGTCGCTAGTCAAGCTGCTGCGACCTGAGATGGTTCCCAAC
CTCAAGACGCTCGCCCTAGGTGGTGAGCCACTCAGCAAAGTCGACATCGAGACATGGGCACCACACTTGCAACTA
ATCAACGGATACGGTCCATCCGAGTGTTCCGTCGCCGCGGCGGGCGATCCACATCTAAAACCGACGAGTGATCCA
TCAAATATAGGCCGCGCCGTAGGCGGTCTTTGCTGGATCGTGGATGCCGAAAATCACGACCGGCTCGTCCCCCTT
GGCGCCGTCGGCGAGTTATTAATCTCCGGCCCCATTCTCGCACGGGGATATTTGAATGATGCGGAAAAGACGGCC
GCCTCCTTCATTGAGAACCCGACCTGGACTGGAGGCTGGTCGCTGACACCATCAGACGCGACGGTCTCAAGTGAA
AGCGCATCCATGCGCTTCTACAAGACTGGTGACTTGGCCCGGTTCAACCTTGACGGCACCATCCAGATCCTTGGG
CGCAAAGACACCCAAGTCAAACTCCGTGGATTACGTGTGGAGTTGGGCGAAATTGAGCACAACATCGCTCGCCAC
CCCCACATCAAACATGCTGCAGCGTTCCTCCCCAAGACTGGGCGGTGTAAGGAGAAAATCGTCGCCGTTGTATGT
CTGAAAGACTTCGCTCAGGACTCCAAAGCTGGTCGATCCGATGCGCCCATCAACGTGCTGTTTGAAGATGAGAGG
CCAGATGTTAAGGATCAGGCCGATGCCGTTCGGAACCACCTGCGCGAATGTGTGCCGGAATACATGGTTCCCGCC
GTCTGGATCGTGATCGAGGCATGGCCGCTATTGGTGTCGGCCAAGCTCGATCGCAAGCGGGTCTTTAGCTGGCTG
TTGGACATGGATGAGGGCCTGTATAATCGCCTTTTGGGTTTGCTCGGTACTGACGAGTCAGAAAACGGCTCTTCG
GATGAGAAGTCTGACGCCCATCTGTCCGAGGTCGAACGAACCCTTCGCGACATCTTTGCTCATGCCTTAAATACT
CCCGCTCACAGTTTGCCGCTGGACAAGTCTTTCATTGCGCTTGGTGGCGACAGTCTCGCTGCCATGCGTGTGATC
TCACAATGCCAGCGTGCGGGCTTGAATGTGACAGTCCCGGACATGATGAAGAGTAAATGCATCAAGGACCTGGCT
GCCCGTGTGGAGAAGACATCTGGGATGAAAACAAAGCCAGATGTTTTGGATGTCTCATTTCCACTTTCGCGGGCT
CAGCAGTTCTGCCTGGGTGACGGGAGGGCGGCAAACCATCTCACGCAGAGCATTCTTCTGAAACTGGATAGCACT
GTTTCGGCCGCTCGTGTCAAGGCTGCGTTGGAAGCCATTGTCACCCGCCACTCCATGTTGCGGGCGCGCTTTGGT
GAATCAGAAGGAAATGGCGCCCTGTCTCTCAGACAGACAGTCACCTCTGAGATCAAGGGTTCTTACAGCTTTCAG
CATCACCGCATAGAACGTCCTGAAGATATCACCACCATCGCAGCCACAGCAGACGCCGTGTCCCTCTCTGGACCG
ATCTTCTCCGCTGGTCTGGTTACAGGAGCGGAAAAGCAGCTGTTGGTCTTGAGAGCCCACAGTGCTGTGGTCGAC
GGCGCCTCCTGGAGCATCATCATCCGGCAGCTCCAGACCTGCTTGAGTCTTCCCGATGGGCCTCTTCTGGGCGAA
GAAGCCCAGGAGCCAGTCTCTTTCCAGAACTGGGTTAGTGTCGAGAGAGAGACAACGGGTGACGAGATTGCAGTC
GCGCCACGCATTCTGCTAGCATCGGAGGTTGACATGGACTACCAGGCAGTGGAGCTTGACCAGGCAACAACTACT
CTGCTCTTGAGCGAGGAAGTACACAAGCCACTGCGGACTCACGTCGTCGACTTCATGATGGCAGGTCTGATGCTT
TCATTTAGGCAAACATTTGGCGGCCGGGAGACCCTACCTACATTTGCTTTGTGGGAGGATGAGCGTGGACGCGCG
TCTGAAGATTTTGGCATTGACCTCTCGCAAACCGTTGGTCGATTCGAGACTCTGCGTGCATTGAATCTCGACACG
GCCGATATGAGCACCAACGACGCGCAAGTGCGCATGTTGAAGGGGATCAAGGACGCCCGGAAAACGACAATGGAG
CCAAGCAGTATTCAGAACCCGGAGATCTCGTTTCGCTACCGTGATCTGTCGAACATTATTGACGGTCCTCGCAGC
CTTGTGCAAATCAAACCGCGTCCCGTCTTTCTCCCTGCGCCCGGAGCAGCTCCTTTGGTTAGCAACATCTCCATT
GTGGCGGAAGTCATCGATGAGAATATTCAGCTTGCCTTCTCTTTTAACAAGAAGGTTGTTCAAGAGAACCAGGTC
AAGGCGTGGATTGCGACCGCGCAGGAAACGCTTGCTTCCCTTGTTGTCAAGATGGTCAACGCCCCGGTTGAATAC
ACCCCATCAGACTTCCCGTTATTGCACGGAATCAGCTACAACACCCTGGACAAGCTCATCAACGAACAACTGCCC
CAGATCGGCCTTATTCCTGGGCCTGAGTCTTCGTTGATCGAAGACATTTATCCATGCTCACCCATGCAGCAGGAC
CTGTTGCTTAGCCAGCACCGGTCCGCGGATGACATGTATGATGTCTACCATATCGCGGAACTGAGGCCACGCGAT
CCCAGGGAGTCGGTGTCTGTTGAGCGACTTGTGAAGTCGTGGACAGAGGTCGTGCAGCGACACACGTCTCTCCGG
ACAATCTTCGTTGAAAGCTCCGACAGTGAGGCACAGTTCAACCAGGTCGTGCTGGCCCGTACCCAGCCTAGCATC
TCCATCGTGGACTGCAATAGCCCTGACGAAGATTTCGCGTCCGTCCTTGCCAACCAAGACCCCATCTCGATCAGA
GGACCCGAGCCTGCGCATCGGTTGTCTATCTGCCGCATTGCAGAAGCCAGTCACGTTGTCATCAAACTAGAGATG
AACCATGTCATCGTGGATGGCGTCTCTGCGGCTGTGATTGTCCGTGATCTACTGCAGGCGTATGATGGGCATGCG
GCGCAATTGGAGCCTGCAATGCCGTTCCGCAACTACATCTCCCACATCCGCGAGACGCCTCTGGAATCATCAATC
GACTTTTGGGCAGATTACCTCAGGGGTCAGAGTGCGACCATGGTTCCCAGGCTGGCCAGCCTAGAGACTGAGAAC
CAAGGTAAGAGACAGTTGAACGTGGTGTCAGTTCCCCTGAAAGAGGAGGGCGTCTCAAATGAGGCGCTTCTCGAC
TTCTGCCGGAGGGCCTCCGTCACCCCTGCCAATGTGTTTCAGGCTGCCTGGGCACTGGTACTCCGGGCTTATGCC
GAGTCGCCCGAGCAAGTCTGCTTCGGTTACCTCTCGGCAGGACGCGACGCTCCCCTCCCAGGCATCCAAGAAGGA
GTCGGTGCTTTCCTCACTATGCTGGTGAGCCGTCTGTCTTTTGCAACCGAGGAGAAGGAGAACGAAGGTGATAAG
ACTGCCACCGTTACTACATTGCTGGACGCAGTGCACATTGTTGCCGAAGACTACGTCAACGCCCTGCCTCACCAG
CACGTTGGTCTCTCCAACATCCAGCACGCACTCAAGACAGGAGGCAGTCCACTCTTCAATACCATCATTGCAGTA
AACCGTGATGTTGACAGCCCAGCCGATTCGTCACTCATCTTCAAGAACATCGGGGATCACGAACCCGATGAGTAC
GCCATCGTCCTAGACGTACAGCTCAACGGCTCTAACACGGCGCGTGCTTCACTCCGTCACTGGACCGATCACTTG
ACGGCCAAGCAAGCAGGCAATATTGCGAGTGCGCTCGGTAATGCCGTTCAAGCAATTATAACCCGGCCGGATACC
CCTATCAGCGAGGTCGAACTTGTGGGCGTCGCCCATAAGGATCAATTGTTGTCCTTCAACACCCACCAACTGCCA
CGGGCAAACCGATTGATCTTCACGAATTTCGAGAAGCTCGCCCGCGTGCAGCCTCACGCTCCGGCGGTGTGTGCT
TGGGATGGCGAGTGGATATACAGCCAACTCGATGAGGTATCCAACCGCCTCGCTCACTACCTGCGTACCTTAGGG
GTAGGTCCCGAGGCCGTTGTGCCACACTGTTTCCCGAAGTCGGGTTGGACCATCGTGACGTGCCTTGCGATTCTG
AAAGCCGGTGGTGCCTTCGTCGGGCTGGATCCGACCCATCCAAGAAAGCGACTGGAGGGTTTGGTCCAAGAAGCC
GGAGCGAAGGTGGTGTGTGTGGCACCGCAGAATCGGGACTTGTTCGAAGGGTGCGACAACTTGAGCATTGTGGAG
ATCACGCCAGAGTTCGTTGCTAAGCTCCCTTCAAAGTCTGGCCCGGCATGCGGCTACATCCAGCCAAACAATGCG
GCTTGCGTCGTTTTCACGTCTGGTACGACCGGTCGGCCCAAGGCTGTAGTGGTGGAACATGCCTCGATGGCGACC
CTGTCAGATCTCATGGGTCCGGCGGTTCGTATCGGTCCAGAGGCTCGCGTCTTCCAGTTCGCCAGTTACACCTTT
GATACATCGAATCAGGACATTTTCACCACCCTCCAGCGCGGTGGCTGCGTTTGCGTGCCGTCAGATGAGGACCGT
GTCAACGATATCCCTGGAGCATTGAACCGCCTTCGCGCTAACCACGCCCACTTGACCAGCACTGTTATTAGTCTC
ATGCGCCCGGAGCAGGTCCCCCAGCTCCGATGGCTGTTTAGCGCTGGCGAGCCCCTTACCCGGGAGAACGTGGAG
ATCTGGGCGCCAGCAGTCGAGCTTTACAACAGTTATGGCCCGGCCGAGTCATCTGTCGCCGTCACTTGTACTCCC
ACCCGTCTGAGCCCGAGTGGCAGCCCAGCAAACATCGGTCAGGCCTTTGGTTGCCACGCATGGATCGCGGATCCC
ACCGACTACCACAAGCTGATGCCTCTGGGTGCCGTGGGAGAGCTCCTTCTTGAGGGTCCGCTGCTCGCGCGTCAC
TACCTGAACAACCCAGAACAGACAGCAGCAGCCTTTGTCCAGAACCCCCGATGGGCGAAGAGTATGAGTCCGGAC
CAGAACCGGCGATTCTACCGAACCGGCGATCTGTGTCGCTTCAACCGTGACGGCAGTCTGACCATCATCGGCCGC
CGTGATAGCCAGATCAAGATTCACGGCCAGCGCGTTGAGCTTGACCACATCAAGTACGAAGTTCAGGCCCAGCTC
GCCCAGCTTGATCAATCGAGTCTGGTTTCCGTTGATGCTGTGATGCTTCCAAAGGCCCAAATCCAGGACCGAACT
TTGGTAGCATTCGTTCAGTTTCTCGACGAGGCGCCTGCGAAGCCCCTGGACACTTTGTCCATTCCCATGACTGAG
AGGCTCGCCCGCCTGTTCTCCGACCTGCAGCGAGCCCTCAAGTCAAGCCTACCTCAATACATGGTCCCGGCCATG
TTCGTCCCAATCACGCAGATTCCACGAACCGCGAACGGCAAGCTGGCTCGTAATGTCCTGCGGGAGATAATCGCT
GGTCTTTCCGAGGCCGACGTTTCTCGTTACATGCTGCAGGGTGAGACCGCGAAGAAAGCCCCGACGACACCCCGT
GAGCAGAAGCTTCAAGCCGCCTGGAGTAAAGTCCTGAACTTGCCCTTGGAGAAGGTGGGCGCTTCTGATGACTTC
TTCCAACTTGGAGGCGACTCAGTTGTGGCCATGCGGCTTGCAGGCGCTGCACGAGTGGCAGGCATGTCCTTGACT
TTCGCGGACATCTTCGCGAATCCCGTCTTGTCCGACATGGCTCAAGTTGTACGAATGGGCGATGAATCTAGAGAA
CAGGAGACAGATGAGAAAGCATTTGACCTTGTCCCACTGTCATCCACGTCATCACTGCAGACGATTCGCGCCGAA
GCGGCAACACAGTGTGGTGTCAGGCCTGATGCCATCGTTGATATGTACCCATCCACCCCACTACAGGAGGGTCTG
GTCGCTCTTTCGATGCGACAAACCGGAGCGTACAAGGATCAACTCATCCTGCGCCTCACAGACCCAAATTACGAC
GTGTCCAGATTCCGCCGTGCGTTCGATGCCGTTGTCTCCGCCGAGCCTATTTTCCGAACGCGCTTTGTGAGCGTC
AGTGGCGCCGGACTCCTCCAGGCGGTACTGAATGTCCCGGTTGACTGGATCAAGCGCGACAATCTGGCCGCGTAT
CTCGAGGAGGATTTAAACGCTCCGATGACCTATGGAAGTGCGCTCATCCGTCTCGCCATGGTAGAGGAGAACGGA
GAACGTTACATCGTGTGGTCAGGACACCATGCACTGTGCGACGGCTTCAGCATGGACATCACATTCGAACAGATT
GCCCACGCGATGGCACACGAGGGTTCCGTGGTCCCCAAGCCGGTCTCCTTCAAGGGATTCATCCGCTTCTTGCAG
GATCAGGATCGAGACAGCTCTGCCAGGGAGTACTGGCAGAAGCAGTTCCCTGCTGACGGCGAGGCACCGCCCCAA
TTTCCACCCAGGCCACAAGGCCACCAGGTTGTCCCTCATCGTGCTTGTCGCCTACAATTCCAGCTGAATCGCCCG
GCTGGTACCAAGATCTCAGTGACGAACTATCTGCGCGCCGCATGGGGTCTCGTCGTGGCTCGACACCAGGACAGC
TCGGACGTCCTGTTCGGCGTGACCCTTTCTGGCCGAAACGCCCCGGTTGCAGGTATCTCTACCATGAACGGGCCC
ACGATGACAACCGCCCCGTTCCGTATGACCGTTCCGTTGGATAGCGAGACAACGGTAGCTCAGTACCTGGACGCC
CTCCACCAACAGGCCATTACAATGATGCCGTTTGAACACACCGGTCTGCAGAATATTCGTCGTCTCAATGAGCTG
GCCCGTGCGGCTGTAGACAATATGGGACATCGTTTTGCGGTGGAGCCGAGCATCAGCGACGTCAGTGAGGCCCTT
GACGGCATGGAAATTGTAACCGCCGATCTTCCAGAGGGCTTTTACACCGATGCCTTGGTCATCCGCAACTATGAC
CACAGTGATGGAGCAATCGTCGTGGAAGCTCGCTATGATCACACTTTAATATCTGACCGCGATATGCAGAGACTG
CTTAGCCAATACAATCATGTTGTCCAGCAACTGACCAGTCAATCAGAGACGTGCATTCGTGATATCCAAGTGCTT
AGCCCCGACGACATCAGTGAGATCATGTCATGGAATGGTGATCTACCTGAAACAGTACAAGGGTGCGTGCATCAA
CTTGTCGCAGAGCGAGCGAAGGAGCGTCCAGACGCTGAGGCCGTGTGTGCCTGGGACGGAACTTACACCTTCGAA
GAACTGGATGGGGTGACCGAACGCCTTGCAGCCCATCTTCAGGACCTCGGCGTCGGCCCAGAAGTGACGGTCGCT
CTTTGCTTTGACAAGTCCAAATGGAATGTCGTCTCTATGTTATCCATCCTGAAGGCTGGCGGTTGCTACACGGCC
TTGAGTCCGGCATACCCAGCCGCTCGCATGCAGGATATCCTCCAGGATGTCCAAGCACCCCTGGTACTGTGCTCA
CCCCATCATGCAGATAAGTTCTCTGGCATGGCGCCCAAGGTTCTGCCAATCGATGATGCCAGTTTCGAATACCTA
CCCAAACAAACAACAACCGACCGCGTCACCTCCGCAGTGCAACCATCCAATGCAGCACTGATCGTTTTCACCTCC
GGCAGTACGGGTAAGCCCAAGGGCGCAATCATTGAACATCGTGGTTTGTGTTCCATGCAACACTATGAAGGACCT
CATGTACAAATGGGACCGGATACTCGCACACTACAATTCGCCTCCCATGTCTTCGACGTGTCCAACTCGGAGGTT
TTTACCACCTTGATGCGGGGTGGCTGTGTGTGTGTGCCGTCTGAGACCGAGCGACTTAGCGACCTCGCTGGCGCA
GTTAACAAGTACAGAGTGAACTGGTCCTTCCACGTTCCAACAACTGCAGAGACACTCGATCCGGAGCAGATGCCA
GGCTTGAAGCATCTGGCTTTGGGCGGTGAAGCCATCAGTCAAGGCCTGTGTGACCGCTGGGCATCTCGTGTGACA
CTACTCAATTCATATGGACCCTCGGAGTGCAGTATCTGGACGAGTGTCTCGCATCTGCAGCCAGGGACTTTGTCT
CCGAACAACATCGGTCGCGGACTTGGCTGCCGGACATGGATCACCGAAGCAAATGACCACAATCGTCTGGTGGCG
ATTGGGTGCGTGGGTGAACTCTGTGTTGAAGGCCCAATCGTCACACGAGGTTATAAAGCCAATCCCGAACAGACC
GCTGCTGCCTACATCGAGAACCCAGCATTTGCGCGGACTCTGGGCATCCAAGCCATGCGCATCTACAAGACAGGT
GACTTGGTAAAGTATGATGCAGACGGCACTATCCTCTATGTCGGCCGTAAGGATAGCCAAGTCAAGGTCCGTGGA
CAGCGCATTGAGCTGAGCGAGGTGGAACAAAACATCGTGGCCCACGGCTTTGATGCAGACGCTGTCGTTGTCGAA
AAGGTCTTCTTGGATGGGAACAAAGACCGCGTGGCTCTGGCGGCCTTCCTAAGACTCAATTCATCCTCTGAGTCA
ACTGATGCATCTGGGGATGTCGAAAACATGGACGTCGTTCGAGACCAGCTCGTCGCCCTCAAGAACCACTTATTG
GACACCATTCCTCCTCACATGGTCCCCTCTTTCTTTATTCCTCTACGATCCATGCCTGTGACACAGACGGGAAAG
AAGAACCGCAAGGCGCTCAGAACACTCGGTGTATCTTTGTCGTCCGAGCAAAGACAACAGTACACTCTCGACGAT
GAAGCCGATTCATCAAACACCAACGGAGGTCGCGCATGCACAAGCGAAGCTGAGAAGCGGCTCCGAGCATTGTGG
TCTGAAGTCCTCGGAATCTTCCCAGAGGAGTCAATCTCGGCCAACGATAATTTCTTCCACAGAGGAGGTGATTCG
ATTCAAGCGATGCGACTGGCGGCTGCGGCTCGTCGCGCTGGCAAAGCGCTGGCAGTGAGCGACTTGTTCCGCATG
CCGCGGCTGTACCAAATGGCCGAGCTCTGGGAGAGCAGTGTGCAAAGCCAAGACGCAACCATTGCGCCTTTCTCG
CTGCTCCAGCCAGAGATCGTTGACGACGCTATTCAGGAGGCCGTTCGCCAATGTAATGTCGATACGAGCGACATC
GAAGACATTTATCTCTGTTCGGCACTGCAGGAAGGTCTCATGGCAGTCTCCACTCGGAAGCAGGGCTCCTACATC
TCGACAAGAATCTTCGACTTGCCAGCTGATCTCGACATTGATCGCTTCAAGGAAGCATGGCAAAAGGCCGCCGAC
GTCTTCCCGATCTTGCGGACGCGCATTATCCTCGGTCGTGCCTCCGAGTCTCTCCAGGTCGTGCTCAAGGAAAAG
CTAGCATGGCAGACCATCACCGATGAGACATCCTTTAGCCTTCCCGTCATTGAGTACGGAGGCCGTCTGTGCTCC
TTTGCGATCGACGTCGAGGCACGCAAATTTGTCTTGGCCCTCCATCACGCTCTTTATGATGGCTGGAGTGCCACG
GTACTGCTTGGGGCTGTGGAAAAGTTCTACGCGGGTGAGCAATACCAGGTGGGTCCAGGATATAATGTCTTCATT
CGGCATCTCTCTCAAGTTGATCAATCCGAGTCGGACAATTTCTGGAAAGGTCAGCTCAGTGGTACACCCGCACAT
TTCCCCAAGTTGCCCTCCAAAACATACGAGGCCAAGAACAGCGCCAACGTCTCTCACACCATCCGTCTACCAGCG
CCCGAGCATCAACCCACTGGAATACTCAAGTCAACCTTGCTCCGAGCAGCATGGGCCATCGTGAGTTCCAGGCAT
GCCGGGTCCAATGATATCACCTTTGGTGCAGCCCAATCAGGTCGCGACTGCGCTGTCCCTGGCATCGTGGAAGTT
GTCGGCCCAACTGTTACGACGGTACCGGTTCGCATCCAGATCAATGACGACGAGACCATCGTCAACTTCCTCCAG
CGGGTTCAAGAGCAATCTGTCAGCATGATCCCGCACCAGCATGCCGGTGTGCAAACACTTCGACAGCTGGGCAAA
GACGTCCAACCCGCGCTCGACTTCACCACTTTGTTCGAGTTCGGAGAGGATTCCAACCAGAGTGGCTTCATCACT
GAGATAGAAATGCCTGAGCTGCTGGACGGTTTCTGGTCCTATCCTATTGTCTTCGAGTGCCATCTGGCTCAGAGC
GGGGAGACTGTCAACGTTTTGGCACGACATGACCCGACGGTCATTCCCACACACCAGATGGATTGGATCTGCAAG
CAGTTCGAACACGTCGTCGACCAGCTCTACCGTATGGCATCTGATGGGCTCGAGGCTAGAAAGGTTGGTGAGCTC
GACCTCTTCGGCCCAAGTGACTTTACCCAAATCGAGGCCTGGAATGCTAGATGGCCTGTGGGTTCCATAGACGGC
AAGGCAGTTCACGAGGCCATTGCCGAGCAATGCCGACTTCATCCCCAGCACCTCGCCCTCTCAGGCTGGGATGGC
GAAATGACCTACGCGCAGCTAGAGCACTACGCGACAAAGCTAGCCAAGGCACTTGTTCTAAAGGGTGTTGGACTC
GAAGTCATGGTTCCACTCTGCTTTGACAAGTCCACCTGGGCCATCGTGTCTACCATAGCAATCATCAAAGCCGGA
GGCGTCGTTGTGCATCTTGGGCCTACTCACCCGGCGAACCGCAGAAAGGAGATCTTGAAGACGATCGGAGCCGAG
TTTGTATTGGTCTCGCCGCAACACACTGGCATCTTTGATGATGCCGCTGTCACAACCATCCCGATTGACCGAGAG
TATTTGGATCGACTGCCCGATGTTGACTACGTGGAGCTGCCCAAGGTCAAGCCCTCCAACGCAGTCTATGTTTGC
TTCACTTCAGGAAGCACAGGTCGGCCCAAGGGAATTGTGGTCGAACACGGCAATCTGCGCATGAGCGCACAGGCA
CACGGTGCTCAATTTAAGGTCAACCCTGGCACCAGGGTGTTCCAGTTCTCGGCTTATACTTTCGATATCGGTCTC
GGTGACATATTCATTTCCCTCCAACGCGGAGCCACCATCTGCACGCCATCTGAATGGGAGAGATTGAACGAGCTT
CCTGGAGCCATCACCAAATATCGGGCGAACTTTATGTCGGTCACCCCATCGGTGGCCAAACTTCTCCGCCCAGAG
GCCGTTCCAACACTGCGCACCCTTGTCCTCGGTGGTGAAGCACCCACTCAAGACAATGTGCAAACCTGGTCCGAT
AAACTGAACCTAGTTATCATTTGGGGACCAGCCGAGACCACCATCTACGCATCGGCTACCCCGCCCACGACCCGG
CAAACAAGTGCACAGGGCCTCGGAAACCCAATGGGTAGTGTAATGTGGCTGTGCGATCCAGACAACCACAACAGG
CTGGTGCCCCTTGGTTGCGTGGGTGAGATTGTTGTCGAGGGCCCGCTTGTCTCGCGTGGCTATCTCAAGGACGAG
GCAAAGACGGCAGCTGCGTATATCGAGGATCCAGTTTGGGCTAGGCAGCTGGACAAGAGTGCCTCGCCTCGCCGG
ATGTACAAAACTGGAGATTTGGCACGCTACGACGCCAACGGATATATGTTATTCTCCGGTCGTAAAGACAATCAG
GTGAAGCTCCACGGACAAAGAATGGAGCTGGACGAAGTGGAACACGCCATGTTAAGACACGAAAGAGTGCGCCAG
GCTGTCGCGCGTATCCCTCGGCACGGACCACTCAAAGACAAGCTGGTGGCGATGTTGAGTCTCCATGATGTCTCA
TCGACCAGCTCCCCCGTTGCAAACACAATTATTGTGCTTGATGAAGCCTCCCATGGTATTAAGGTTGGACAGGAA
CTTGCCTCCGTGCGTAAGTTGCTGCAACAAAACCTACCAAGCTACATGGTACCAACGATTTGGATTGGTGTCGAG
GCTGTTCCGCTGAGCGCCAATTCGAAGGTTGATCGGAAATCCGTTGATGCTTGGATGGAAGAGATGGATCAGGAA
ACCTATACCTCGTTGCTGCGCGATGGAGGTAGTGGTGAGAAAGAAGAAGAAATTCGCCGCCCATCCACCCCGGTG
GAACAAATTCTGTGCAACCTCATCAGCAAGATTCTTGGCTTGAGCTCGGAGACACTCAACCTCAACTCTTCGTTC
CTGGCCCTTGGTGGCGACTCCGTAGCTGCAATGCAGCTGCGTAGCAAGTCTCGCGCTGAGGGGGTTACGGTCTCC
ATGCTGGACATTATCAGGAGCAAGAGTCTCGTCGAGCTTGCGTCGAAGGCGGAATATACCGAACCAACTGTGAAG
AAGGTCCAGGAAGGGTCCTTTGATCTCTCGCCAATCCAGCAGATGTACTTCGATCTGGTGGGATCTGCTGCAGAC
GCAAACATTGGTCATTTCGACCAGAGCATTCTTCTGGAAGTCAACAGCGACGTGGCGCCTCAAACGTTGCGACAG
GCCCTCGCACAGGTTGTTCGGCGGCACTCGATGCTCCGCGCCCGATATGCTCGAAATGGTACCGGCCAGTGGTAT
CAGTACCTTGCTGAAGATTCAGCAAATTCATTCCATTTCAGCGTCGAAGACGTGGAAGATGGTTATCAAGTGTCC
AGAATACTGAGGAACATGGGTGGTGTGTTTGACATCGAGAAAGGCCCAGTCTTCGCTGCCCGCGTATACAATCTT
CGTTCAGAGCGCAAACAGTTGATGTTTGTTCATGCTCATCATTTGGTGGTGGATGTGGTTTCGTGGCACGTTCTG
CTGGGCGATCTAGAGCTTGCCATTGCCACTGGCAGCTTGGCCGGCCCAGCTCCGCTCTCTTTCCAGAGTTGGTTG
CGTTCTCAAAAGGACATGGCGCAGTCTCTTGAACCACGAGAGCTGCTACCTTTCTCAAACACAAGCATGCCTGTG
GCCAACTTTGAATATTGGGGAATGGGAGGCAACAAGTCCAACAGATACTGCGACGCCGTCGTGACCGACTTTTGG
CTCGATGAGTCCCTAACTACCCAGTTAATGAGTGTCAGCAAGGGTACTTCAAGCGCTGCCCCTGTCGACATCATT
CTGGCTTCTCTTCTCCACTCCTTTGCGGCCGTCTTCCCTGACCGTTCCGCACCACCAGTCTTCTCTGAGGGCCAT
GGTCGCGAGTCATGGAACAACCAGGTCGATCCTTCCGGCACAGTGGGTTGGTTTACAACTATGAGCCCACTGCAT
GTATCTGATCTGCAATTGGATATTATCAAGACCGTGCAGACCGTAAAGGATCTCCGTCGCCGGCTACCAGCTAAC
GGCATGTCATATTTCAGCTCCAGGTATCTCTCCGACAAAGGGCGCAAAGCCTTTGGTTCTCATTTCGATATGGAG
ATCATGTTCAACTACCTTGGCCGGTCCTCTGAAGTTGGAAGTGAGAACGCCCTTCTCTCGCATGCCGAACTACCA
GACGGCGCGACCTTCGACCAATTGGTCCAAGATGAAAACCTTCCCCGCTGGTCTCTCTTCGACATCGTTGCCCTT
GTCGTTGGCGGCAGAACCCACGTTACCATGGCCTATAACAAGCACATGCAACACCAGGATAGAATCGTTGAGTGG
GCAGCCAAGACAAAGTCCACTCTGAGCCTTGCCATTGAGGTTCTCAGTGGGGTGAAAAGCCTGCCGCTCACTCCG
CCAACCACTCCCAAACCCTCACCCTTGCAGCACCAGCCCCAGGATCAATGCATCACCCTCGACAGCATTGAAGGA
ATTTACCCCTGTGCCCCAGTACAGCGACACATGCTCGCAGAGCGCGAAAAGCACCCCAACCGCCGCTTGTACGAG
ATGGATTTTACTTACCAAGCTCATGCACTCAATGGTGTCGTCGACGTGGATAGAATCCGCGAAGCATGGCACCAG
GTTGTGCAACGCCATCCCGCACTTCGAACTGTCTTCCTTCCCAGCATGTCTTCGCCCGGCTCCTACGACCAAGTT
ATCATTCGGAACTGGCACCCCGAGGTCCCCTTTATCGAGTGCGCCAGTGAGGAGGAGATGACGGCTCGCATGGAC
GCCTACCGATCGGTCAACTACAGCCTCTCGAATAGAAAGCCACACCATCAGCTCACCTTGTTCAGTACAACAGTC
AATGGCGTGCAAAAGGTTGCCTTCAAAACTGAAACAGACCACACCCTTACCGACGGCGTTTCTGTCGCTCTGATC
CTCCGCGACCTGATGCTGGCGTATGAGGGCAAACTTCCCGCCACCCCAGCCCCGTCATTCGGTAGCTATTCTGTC
TGGCTGAACGGGATGAGCCAAGGCGAGACACTAGTTAAGGACAAGGAATACTGGGTGGAGTTCGAGCGGAGCTCA
GGGCCATCACTTATTCCTCATACCGATGCCTCCACCCTTGTACTATCCCAACCCCGGGTCCACAAAACAAAGACC
ATCAACCTGGATTTGGAAACCACCAGCCGACTTCCTGCCTTCTGCGTGCAGCACGGTGTCACTATGGCGGCGTTC
CTCCAGACGGCCTGGGGAATGGTGTTACAGCACCTCACGGGATCTGACAAGACGCTCTTCTCCTTCATGACCGCC
AACAGGGATGCGCCGTTCGCCGGCGCAGCAGAGACCGTCGGTCCGCTCATCCAAATGCTTCTGTGTCGGATCGAT
CTCAGCAACAAGGAGATTGGCGACGTGTTGAGGCAAGCACGAGATGACTTCCTTGAGTCGCTGGAGCATCAGTAC
GGACTGGCCCAGATGGAAGACGTGTGGCAGACCCCAGCGTGGAATTCTCTTATGAGTCTACAGTACATGGACTCG
CGAGTGGGTCAGAAGGCCACGGAGCGGACTGAACTGGAGGTTGAGCTGCGTTCGGCAGAAGATCCCACTGCGTGG
GACGTGTCGATCGGTGTGCAGATCCATAGTCGGGGAGACGGTGTTACTGAAGTGGATGCGGAGCTTGGCTATTGG
TCTGATGTGCTCACGGATGAGCGGGCAGGAGATGTGAAGGATTTGTTTGAAGCATCTGTGAAGAAGATGCTTGAT
GGATGTTGA
Gene >Ani_SJS100_1|g4734.t1
ATGTTTACTCAAGCCACTTCTACTACCCTTGTCGAGAACGTCGGCGTCTCCCATCGCGAGAACCCCGACGCCGAG
CTTGCCGCTCTGATCAACGCTGCCTGGAGCATCGTGGTCTGGCAGTATACCGGCCAGGAAGACACTCGCTTCATC
ACCGCCACTACATCGGGAGAGGCCGACGATCTTGAATCCACCTACCAAGTATGCAACGCACAGCTCGACGGCGCA
ACAACAGTCTCCGACTTCATCCAGCAAACACACCAAGCGACAAAGGAGCTGGCCTCCGACCAGGTCCCTTTGGCC
CCCTCACGAAATGAGGCCGCTACCTCGCCATTCCTGCAATCGATTACGACCCTCACTTCCAACAAGACCTATCTC
AACTCCTCCTCTCCCAGCCATCTGGATGCTACGGGCGCACTAATTGAGCTCGTAGCTATTCCTCTGCCATTTAGC
AAGCTCGAATTCGTGGTGCGTTTTGCGCCATCTACCATCGACCAAGAACGAGCCGATCACCTTGCGGCTGCTTTT
GCGCACGTTCTGGATTTGATCATCGACCCCGACCGGCGTCACGACCGCCTAGATGCCATTGATCTAGTCAGTAAC
TACGATAAGGCAAAGCTTTGGACCTGGAATAGCGTCCAGCTGCCTGAGACGGTCGAATCATGCGTCCATTTCCTC
TTCCGCCAGCGCGCGCAGGAGGAGCCGGACATGCTCGCTGTGGACGCCTGGGACGGCCGCTTCACGTATGGCGAG
CTGGACGCTATTTCCGATCGCATCGCAGTCTGGCTAGCCCGAGAAGAGGGCATCCGACCGGAATCCATTGTACCC
CTGTGCTTTGAGAAGAGCCGCTGGGCCATCGCCGCCCTGTTGGGTGTGATCAAAGCGGGTGGTGCTATTGTGTTT
ATTGACCCAGCTAACCCAGTCAGCCGCAGGCAAGATATCATGGATCAAATCGAAGGTAAGTGGGTACTGAGCTCG
AAAAGCCAGGCCGAAACGTGGGAAAATGAAATGGGCGTGCGAACCATCGTCTTAGACGAACAATTCGCCGCCTCC
CTGCCGGTCGAGGATCATATCCTCGAGTCCGGCGTTACCCCTAACAGCCTCCTCTACCTTATTTTTACTTCCGGA
AGCACAGGTAAGCCGAAAGGCTGTCTCATCCCGCACAAGGCATTCATCTCGGGTGCCCTCGTACACGCCTCTCTA
TCCAATCTCTCCCGCGGTTGTCGTGTCTTGCAGCTCGCCTCGTACAGTTTCGATGTGAGCATGTTGGAGATCATG
ACTTCCCTTATCTCGGGTGCATGTGTATGCACCCCAGACATGGCGAGCATGGCACAGGGTCTCCAGCCCATCTTC
GACAAATTCGACATCACATGGGCCTTCTTGACGCCGTCGCTAGTCAAGCTGCTGCGACCTGAGATGGTTCCCAAC
CTCAAGACGCTCGCCCTAGGTGGTGAGCCACTCAGCAAAGTCGACATCGAGACATGGGCACCACACTTGCAACTA
ATCAACGGATACGGTCCATCCGAGTGTTCCGTCGCCGCGGCGGGCGATCCACATCTAAAACCGACGAGTGATCCA
TCAAATATAGGCCGCGCCGTAGGCGGTCTTTGCTGGATCGTGGATGCCGAAAATCACGACCGGCTCGTCCCCCTT
GGCGCCGTCGGCGAGTTATTAATCTCCGGCCCCATTCTCGCACGGGGATATTTGAATGATGCGGAAAAGACGGCC
GCCTCCTTCATTGAGAACCCGACCTGGACTGGAGGCTGGTCGCTGACACCATCAGACGCGACGGTCTCAAGTGAA
AGCGCATCCATGCGCTTCTACAAGACTGGTGACTTGGCCCGGTTCAACCTTGACGGCACCATCCAGATCCTTGGG
CGCAAAGACACCCAAGTCAAACTCCGTGGATTACGTGTGGAGTTGGGCGAAATTGAGCACAACATCGCTCGCCAC
CCCCACATCAAACATGCTGCAGCGTTCCTCCCCAAGACTGGGCGGTGTAAGGAGAAAATCGTCGCCGTTGTATGT
CTGAAAGACTTCGCTCAGGACTCCAAAGCTGGTCGATCCGATGCGCCCATCAACGTGCTGTTTGAAGATGAGAGG
CCAGATGTTAAGGATCAGGCCGATGCCGTTCGGAACCACCTGCGCGAATGTGTGCCGGAATACATGGTTCCCGCC
GTCTGGATCGTGATCGAGGCATGGCCGCTATTGGTGTCGGCCAAGCTCGATCGCAAGCGGGTCTTTAGCTGGCTG
TTGGACATGGATGAGGGCCTGTATAATCGCCTTTTGGGTTTGCTCGGTACTGACGAGTCAGAAAACGGCTCTTCG
GATGAGAAGTCTGACGCCCATCTGTCCGAGGTCGAACGAACCCTTCGCGACATCTTTGCTCATGCCTTAAATACT
CCCGCTCACAGTTTGCCGCTGGACAAGTCTTTCATTGCGCTTGGTGGCGACAGTCTCGCTGCCATGCGTGTGATC
TCACAATGCCAGCGTGCGGGCTTGAATGTGACAGTCCCGGACATGATGAAGAGTAAATGCATCAAGGACCTGGCT
GCCCGTGTGGAGAAGACATCTGGGATGAAAACAAAGCCAGATGTTTTGGATGTCTCATTTCCACTTTCGCGGGCT
CAGCAGTTCTGCCTGGGTGACGGGAGGGCGGCAAACCATCTCACGCAGAGCATTCTTCTGAAACTGGATAGCACT
GTTTCGGCCGCTCGTGTCAAGGCTGCGTTGGAAGCCATTGTCACCCGCCACTCCATGTTGCGGGCGCGCTTTGGT
GAATCAGAAGGAAATGGCGCCCTGTCTCTCAGACAGACAGTCACCTCTGAGATCAAGGGTTCTTACAGCTTTCAG
CATCACCGCATAGAACGTCCTGAAGATATCACCACCATCGCAGCCACAGCAGACGCCGTGTCCCTCTCTGGACCG
ATCTTCTCCGCTGGTCTGGTTACAGGAGCGGAAAAGCAGCTGTTGGTCTTGAGAGCCCACAGTGCTGTGGTCGAC
GGCGCCTCCTGGAGCATCATCATCCGGCAGCTCCAGACCTGCTTGAGTCTTCCCGATGGGCCTCTTCTGGGCGAA
GAAGCCCAGGAGCCAGTCTCTTTCCAGAACTGGGTTAGTGTCGAGAGAGAGACAACGGGTGACGAGATTGCAGTC
GCGCCACGCATTCTGCTAGCATCGGAGGTTGACATGGACTACCAGGCAGTGGAGCTTGACCAGGCAACAACTACT
CTGCTCTTGAGCGAGGAAGTACACAAGCCACTGCGGACTCACGTCGTCGACTTCATGATGGCAGGTCTGATGCTT
TCATTTAGGCAAACATTTGGCGGCCGGGAGACCCTACCTACATTTGCTTTGTGGGAGGATGAGCGTGGACGCGCG
TCTGAAGATTTTGGCATTGACCTCTCGCAAACCGTTGGTCGATTCGAGACTCTGCGTGCATTGAATCTCGACACG
GCCGATATGAGCACCAACGACGCGCAAGTGCGCATGTTGAAGGGGATCAAGGACGCCCGGAAAACGACAATGGAG
CCAAGCAGTATTCAGAACCCGGAGATCTCGTTTCGCTACCGTGATCTGTCGAACATTATTGACGGTCCTCGCAGC
CTTGTGCAAATCAAACCGCGTCCCGTCTTTCTCCCTGCGCCCGGAGCAGCTCCTTTGGTTAGCAACATCTCCATT
GTGGCGGAAGTCATCGATGAGAATATTCAGCTTGCCTTCTCTTTTAACAAGAAGGTTGTTCAAGAGAACCAGGTC
AAGGCGTGGATTGCGACCGCGCAGGAAACGCTTGCTTCCCTTGTTGTCAAGATGGTCAACGCCCCGGTTGAATAC
ACCCCATCAGACTTCCCGTTATTGCACGGAATCAGCTACAACACCCTGGACAAGCTCATCAACGAACAACTGCCC
CAGATCGGCCTTATTCCTGGGCCTGAGTCTTCGTTGATCGAAGACATTTATCCATGCTCACCCATGCAGCAGGAC
CTGTTGCTTAGCCAGCACCGGTCCGCGGATGACATGTATGATGTCTACCATATCGCGGAACTGAGGCCACGCGAT
CCCAGGGAGTCGGTGTCTGTTGAGCGACTTGTGAAGTCGTGGACAGAGGTCGTGCAGCGACACACGTCTCTCCGG
ACAATCTTCGTTGAAAGCTCCGACAGTGAGGCACAGTTCAACCAGGTCGTGCTGGCCCGTACCCAGCCTAGCATC
TCCATCGTGGACTGCAATAGCCCTGACGAAGATTTCGCGTCCGTCCTTGCCAACCAAGACCCCATCTCGATCAGA
GGACCCGAGCCTGCGCATCGGTTGTCTATCTGCCGCATTGCAGAAGCCAGTCACGTTGTCATCAAACTAGAGATG
AACCATGTCATCGTGGATGGCGTCTCTGCGGCTGTGATTGTCCGTGATCTACTGCAGGCGTATGATGGGCATGCG
GCGCAATTGGAGCCTGCAATGCCGTTCCGCAACTACATCTCCCACATCCGCGAGACGCCTCTGGAATCATCAATC
GACTTTTGGGCAGATTACCTCAGGGGTCAGAGTGCGACCATGGTTCCCAGGCTGGCCAGCCTAGAGACTGAGAAC
CAAGGTAAGAGACAGTTGAACGTGGTGTCAGTTCCCCTGAAAGAGGAGGGCGTCTCAAATGAGGCGCTTCTCGAC
TTCTGCCGGAGGGCCTCCGTCACCCCTGCCAATGTGTTTCAGGCTGCCTGGGCACTGGTACTCCGGGCTTATGCC
GAGTCGCCCGAGCAAGTCTGCTTCGGTTACCTCTCGGCAGGACGCGACGCTCCCCTCCCAGGCATCCAAGAAGGA
GTCGGTGCTTTCCTCACTATGCTGGTGAGCCGTCTGTCTTTTGCAACCGAGGAGAAGGAGAACGAAGGTGATAAG
ACTGCCACCGTTACTACATTGCTGGACGCAGTGCACATTGTTGCCGAAGACTACGTCAACGCCCTGCCTCACCAG
CACGTTGGTCTCTCCAACATCCAGCACGCACTCAAGACAGGAGGCAGTCCACTCTTCAATACCATCATTGCAGTA
AACCGTGATGTTGACAGCCCAGCCGATTCGTCACTCATCTTCAAGAACATCGGGGATCACGAACCCGATGAGTAC
GCCATCGTCCTAGACGTACAGCTCAACGGCTCTAACACGGCGCGTGCTTCACTCCGTCACTGGACCGATCACTTG
ACGGCCAAGCAAGCAGGCAATATTGCGAGTGCGCTCGGTAATGCCGTTCAAGCAATTATAACCCGGCCGGATACC
CCTATCAGCGAGGTCGAACTTGTGGGCGTCGCCCATAAGGATCAATTGTTGTCCTTCAACACCCACCAACTGCCA
CGGGCAAACCGATTGATCTTCACGAATTTCGAGAAGCTCGCCCGCGTGCAGCCTCACGCTCCGGCGGTGTGTGCT
TGGGATGGCGAGTGGATATACAGCCAACTCGATGAGGTATCCAACCGCCTCGCTCACTACCTGCGTACCTTAGGG
GTAGGTCCCGAGGCCGTTGTGCCACACTGTTTCCCGAAGTCGGGTTGGACCATCGTGACGTGCCTTGCGATTCTG
AAAGCCGGTGGTGCCTTCGTCGGGCTGGATCCGACCCATCCAAGAAAGCGACTGGAGGGTTTGGTCCAAGAAGCC
GGAGCGAAGGTGGTGTGTGTGGCACCGCAGAATCGGGACTTGTTCGAAGGGTGCGACAACTTGAGCATTGTGGAG
ATCACGCCAGAGTTCGTTGCTAAGCTCCCTTCAAAGTCTGGCCCGGCATGCGGCTACATCCAGCCAAACAATGCG
GCTTGCGTCGTTTTCACGTCTGGTACGACCGGTCGGCCCAAGGCTGTAGTGGTGGAACATGCCTCGATGGCGACC
CTGTCAGATCTCATGGGTCCGGCGGTTCGTATCGGTCCAGAGGCTCGCGTCTTCCAGTTCGCCAGTTACACCTTT
GATACATCGAATCAGGACATTTTCACCACCCTCCAGCGCGGTGGCTGCGTTTGCGTGCCGTCAGATGAGGACCGT
GTCAACGATATCCCTGGAGCATTGAACCGCCTTCGCGCTAACCACGCCCACTTGACCAGCACTGTTATTAGTCTC
ATGCGCCCGGAGCAGGTCCCCCAGCTCCGATGGCTGTTTAGCGCTGGCGAGCCCCTTACCCGGGAGAACGTGGAG
ATCTGGGCGCCAGCAGTCGAGCTTTACAACAGTTATGGCCCGGCCGAGTCATCTGTCGCCGTCACTTGTACTCCC
ACCCGTCTGAGCCCGAGTGGCAGCCCAGCAAACATCGGTCAGGCCTTTGGTTGCCACGCATGGATCGCGGATCCC
ACCGACTACCACAAGCTGATGCCTCTGGGTGCCGTGGGAGAGCTCCTTCTTGAGGGTCCGCTGCTCGCGCGTCAC
TACCTGAACAACCCAGAACAGACAGCAGCAGCCTTTGTCCAGAACCCCCGATGGGCGAAGAGTATGAGTCCGGAC
CAGAACCGGCGATTCTACCGAACCGGCGATCTGTGTCGCTTCAACCGTGACGGCAGTCTGACCATCATCGGCCGC
CGTGATAGCCAGATCAAGATTCACGGCCAGCGCGTTGAGCTTGACCACATCAAGTACGAAGTTCAGGCCCAGCTC
GCCCAGCTTGATCAATCGAGTCTGGTTTCCGTTGATGCTGTGATGCTTCCAAAGGCCCAAATCCAGGACCGAACT
TTGGTAGCATTCGTTCAGTTTCTCGACGAGGCGCCTGCGAAGCCCCTGGACACTTTGTCCATTCCCATGACTGAG
AGGCTCGCCCGCCTGTTCTCCGACCTGCAGCGAGCCCTCAAGTCAAGCCTACCTCAATACATGGTCCCGGCCATG
TTCGTCCCAATCACGCAGATTCCACGAACCGCGAACGGCAAGCTGGCTCGTAATGTCCTGCGGGAGATAATCGCT
GGTCTTTCCGAGGCCGACGTTTCTCGTTACATGCTGCAGGGTGAGACCGCGAAGAAAGCCCCGACGACACCCCGT
GAGCAGAAGCTTCAAGCCGCCTGGAGTAAAGTCCTGAACTTGCCCTTGGAGAAGGTGGGCGCTTCTGATGACTTC
TTCCAACTTGGAGGCGACTCAGTTGTGGCCATGCGGCTTGCAGGCGCTGCACGAGTGGCAGGCATGTCCTTGACT
TTCGCGGACATCTTCGCGAATCCCGTCTTGTCCGACATGGCTCAAGTTGTACGAATGGGCGATGAATCTAGAGAA
CAGGAGACAGATGAGAAAGCATTTGACCTTGTCCCACTGTCATCCACGTCATCACTGCAGACGATTCGCGCCGAA
GCGGCAACACAGTGTGGTGTCAGGCCTGATGCCATCGTTGATATGTACCCATCCACCCCACTACAGGAGGGTCTG
GTCGCTCTTTCGATGCGACAAACCGGAGCGTACAAGGATCAACTCATCCTGCGCCTCACAGACCCAAATTACGAC
GTGTCCAGATTCCGCCGTGCGTTCGATGCCGTTGTCTCCGCCGAGCCTATTTTCCGAACGCGCTTTGTGAGCGTC
AGTGGCGCCGGACTCCTCCAGGCGGTACTGAATGTCCCGGTTGACTGGATCAAGCGCGACAATCTGGCCGCGTAT
CTCGAGGAGGATTTAAACGCTCCGATGACCTATGGAAGTGCGCTCATCCGTCTCGCCATGGTAGAGGAGAACGGA
GAACGTTACATCGTGTGGTCAGGACACCATGCACTGTGCGACGGCTTCAGCATGGACATCACATTCGAACAGATT
GCCCACGCGATGGCACACGAGGGTTCCGTGGTCCCCAAGCCGGTCTCCTTCAAGGGATTCATCCGCTTCTTGCAG
GATCAGGATCGAGACAGCTCTGCCAGGGAGTACTGGCAGAAGCAGTTCCCTGCTGACGGCGAGGCACCGCCCCAA
TTTCCACCCAGGCCACAAGGCCACCAGGTTGTCCCTCATCGTGCTTGTCGCCTACAATTCCAGCTGAATCGCCCG
GCTGGTACCAAGATCTCAGTGACGAACTATCTGCGCGCCGCATGGGGTCTCGTCGTGGCTCGACACCAGGACAGC
TCGGACGTCCTGTTCGGCGTGACCCTTTCTGGCCGAAACGCCCCGGTTGCAGGTATCTCTACCATGAACGGGCCC
ACGATGACAACCGCCCCGTTCCGTATGACCGTTCCGTTGGATAGCGAGACAACGGTAGCTCAGTACCTGGACGCC
CTCCACCAACAGGCCATTACAATGATGCCGTTTGAACACACCGGTCTGCAGAATATTCGTCGTCTCAATGAGCTG
GCCCGTGCGGCTGTAGACAATATGGGACATCGTTTTGCGGTGGAGCCGAGCATCAGCGACGTCAGTGAGGCCCTT
GACGGCATGGAAATTGTAACCGCCGATCTTCCAGAGGGCTTTTACACCGATGCCTTGGTCATCCGCAACTATGAC
CACAGTGATGGAGCAATCGTCGTGGAAGCTCGCTATGATCACACTTTAATATCTGACCGCGATATGCAGAGACTG
CTTAGCCAATACAATCATGTTGTCCAGCAACTGACCAGTCAATCAGAGACGTGCATTCGTGATATCCAAGTGCTT
AGCCCCGACGACATCAGTGAGATCATGTCATGGAATGGTGATCTACCTGAAACAGTACAAGGGTGCGTGCATCAA
CTTGTCGCAGAGCGAGCGAAGGAGCGTCCAGACGCTGAGGCCGTGTGTGCCTGGGACGGAACTTACACCTTCGAA
GAACTGGATGGGGTGACCGAACGCCTTGCAGCCCATCTTCAGGACCTCGGCGTCGGCCCAGAAGTGACGGTCGCT
CTTTGCTTTGACAAGTCCAAATGGAATGTCGTCTCTATGTTATCCATCCTGAAGGCTGGCGGTTGCTACACGGCC
TTGAGTCCGGCATACCCAGCCGCTCGCATGCAGGATATCCTCCAGGATGTCCAAGCACCCCTGGTACTGTGCTCA
CCCCATCATGCAGATAAGTTCTCTGGCATGGCGCCCAAGGTTCTGCCAATCGATGATGCCAGTTTCGAATACCTA
CCCAAACAAACAACAACCGACCGCGTCACCTCCGCAGTGCAACCATCCAATGCAGCACTGATCGTTTTCACCTCC
GGCAGTACGGGTAAGCCCAAGGGCGCAATCATTGAACATCGTGGTTTGTGTTCCATGCAACACTATGAAGGACCT
CATGTACAAATGGGACCGGATACTCGCACACTACAATTCGCCTCCCATGTCTTCGACGTGTCCAACTCGGAGGTT
TTTACCACCTTGATGCGGGGTGGCTGTGTGTGTGTGCCGTCTGAGACCGAGCGACTTAGCGACCTCGCTGGCGCA
GTTAACAAGTACAGAGTGAACTGGTCCTTCCACGTTCCAACAACTGCAGAGACACTCGATCCGGAGCAGATGCCA
GGCTTGAAGCATCTGGCTTTGGGCGGTGAAGCCATCAGTCAAGGCCTGTGTGACCGCTGGGCATCTCGTGTGACA
CTACTCAATGTGCGTTTTCTCTACATCTCTCTATTTCAGTTTTATTTGACCTCAGTGCTAACCCATAACAGTCAT
ATGGACCCTCGGAGTGCAGTATCTGGACGAGTGTCTCGCATCTGCAGCCAGGGACTTTGTCTCCGAACAACATCG
GTCGCGGACTTGGCTGCCGGACATGGATCACCGAAGCAAATGACCACAATCGTCTGGTGGCGATTGGGTGCGTGG
GTGAACTCTGTGTTGAAGGCCCAATCGTCACACGAGGTTATAAAGCCAATCCCGAACAGACCGCTGCTGCCTACA
TCGAGAACCCAGCATTTGCGCGGACTCTGGGCATCCAAGCCATGCGCATCTACAAGACAGGTGACTTGGTAAAGT
ATGATGCAGACGGCACTATCCTCTATGTCGGCCGTAAGGATAGCCAAGTCAAGGTCCGTGGACAGCGCATTGAGC
TGAGCGAGGTGGAACAAAACATCGTGGCCCACGGCTTTGATGCAGACGCTGTCGTTGTCGAAAAGGTCTTCTTGG
ATGGGAACAAAGACCGCGTGGCTCTGGCGGCCTTCCTAAGACTCAATTCATCCTCTGAGTCAACTGATGCATCTG
GGGATGTCGAAAACATGGACGTCGTTCGAGACCAGCTCGTCGCCCTCAAGAACCACTTATTGGACACCATTCCTC
CTCACATGGTCCCCTCTTTCTTTATTCCTCTACGATCCATGCCTGTGACACAGACGGGAAAGAAGAACCGCAAGG
CGCTCAGAACACTCGGTGTATCTTTGTCGTCCGAGCAAAGACAACAGTACACTCTCGACGATGAAGCCGATTCAT
CAAACACCAACGGAGGTCGCGCATGCACAAGCGAAGCTGAGAAGCGGCTCCGAGCATTGTGGTCTGAAGTCCTCG
GAATCTTCCCAGAGGAGTCAATCTCGGCCAACGATAATTTCTTCCACAGAGGAGGTGATTCGATTCAAGCGATGC
GACTGGCGGCTGCGGCTCGTCGCGCTGGCAAAGCGCTGGCAGTGAGCGACTTGTTCCGCATGCCGCGGCTGTACC
AAATGGCCGAGCTCTGGGAGAGCAGTGTGCAAAGCCAAGACGCAACCATTGCGCCTTTCTCGCTGCTCCAGCCAG
AGATCGTTGACGACGCTATTCAGGAGGCCGTTCGCCAATGTAATGTCGATACGAGCGACATCGAAGACATTTATC
TCTGTTCGGCACTGCAGGAAGGTCTCATGGCAGTCTCCACTCGGAAGCAGGGCTCCTACATCTCGACAAGAATCT
TCGACTTGCCAGCTGATCTCGACATTGATCGCTTCAAGGAAGCATGGCAAAAGGCCGCCGACGTCTTCCCGATCT
TGCGGACGCGCATTATCCTCGGTCGTGCCTCCGAGTCTCTCCAGGTCGTGCTCAAGGAAAAGCTAGCATGGCAGA
CCATCACCGATGAGACATCCTTTAGCCTTCCCGTCATTGAGTACGGAGGCCGTCTGTGCTCCTTTGCGATCGACG
TCGAGGCACGCAAATTTGTCTTGGCCCTCCATCACGCTCTTTATGATGGCTGGAGTGCCACGGTACTGCTTGGGG
CTGTGGAAAAGTTCTACGCGGGTGAGCAATACCAGGTGGGTCCAGGATATAATGTCTTCATTCGGCATCTCTCTC
AAGTTGATCAATCCGAGTCGGACAATTTCTGGAAAGGTCAGCTCAGTGGTACACCCGCACATTTCCCCAAGTTGC
CCTCCAAAACATACGAGGCCAAGAACAGCGCCAACGTCTCTCACACCATCCGTCTACCAGCGCCCGAGCATCAAC
CCACTGGAATACTCAAGTCAACCTTGCTCCGAGCAGCATGGGCCATCGTGAGTTCCAGGCATGCCGGGTCCAATG
ATATCACCTTTGGTGCAGCCCAATCAGGTCGCGACTGCGCTGTCCCTGGCATCGTGGAAGTTGTCGGCCCAACTG
TTACGACGGTACCGGTTCGCATCCAGATCAATGACGACGAGACCATCGTCAACTTCCTCCAGCGGGTTCAAGAGC
AATCTGTCAGCATGATCCCGCACCAGCATGCCGGTGTGCAAACACTTCGACAGCTGGGCAAAGACGTCCAACCCG
CGCTCGACTTCACCACTTTGTTCGAGTTCGGAGAGGATTCCAACCAGAGTGGCTTCATCACTGAGATAGAAATGC
CTGAGCTGCTGGACGGTTTCTGGTCCTATCCTATTGTCTTCGAGTGCCATCTGGCTCAGAGCGGGGAGACTGTCA
ACGTTTTGGCACGACATGACCCGACGGTCATTCCCACACACCAGATGGATTGGATCTGCAAGCAGTTCGAACACG
TCGTCGACCAGCTCTACCGTATGGCATCTGATGGGCTCGAGGCTAGAAAGGTTGGTGAGCTCGACCTCTTCGGCC
CAAGTGACTTTACCCAAATCGAGGCCTGGAATGCTAGATGGCCTGTGGGTTCCATAGACGGCAAGGCAGTTCACG
AGGCCATTGCCGAGCAATGCCGACTTCATCCCCAGCACCTCGCCCTCTCAGGCTGGGATGGCGAAATGACCTACG
CGCAGCTAGAGCACTACGCGACAAAGCTAGCCAAGGCACTTGTTCTAAAGGGTGTTGGACTCGAAGTCATGGTTC
CACTCTGCTTTGACAAGTCCACCTGGGCCATCGTGTCTACCATAGCAATCATCAAAGCCGGAGGCGTCGTTGTGC
ATCTTGGGCCTACTCACCCGGCGAACCGCAGAAAGGAGATCTTGAAGACGATCGGAGCCGAGTTTGTATTGGTCT
CGCCGCAACACACTGGCATCTTTGATGATGCCGCTGTCACAACCATCCCGATTGACCGAGAGTATTTGGATCGAC
TGCCCGATGTTGACTACGTGGAGCTGCCCAAGGTCAAGCCCTCCAACGCAGTCTATGTTTGCTTCACTTCAGGAA
GCACAGGTCGGCCCAAGGGAATTGTGGTCGAACACGGCAATCTGCGCATGAGCGCACAGGCACACGGTGCTCAAT
TTAAGGTCAACCCTGGCACCAGGGTGTTCCAGTTCTCGGCTTATACTTTCGATATCGGTCTCGGTGACATATTCA
TTTCCCTCCAACGCGGAGCCACCATCTGCACGCCATCTGAATGGGAGAGATTGAACGAGCTTCCTGGAGCCATCA
CCAAATATCGGGCGAACTTTATGTCGGTCACCCCATCGGTGGCCAAACTTCTCCGCCCAGAGGCCGTTCCAACAC
TGCGCACCCTTGTCCTCGGTGGTGAAGCACCCACTCAAGACAATGTGCAAACCTGGTCCGATAAACTGAACCTAG
TTATCATTTGGGGACCAGCCGAGACCACCATCTACGCATCGGCTACCCCGCCCACGACCCGGCAAACAAGTGCAC
AGGGCCTCGGAAACCCAATGGGTAGTGTAATGTGGCTGTGCGATCCAGACAACCACAACAGGCTGGTGCCCCTTG
GTTGCGTGGGTGAGATTGTTGTCGAGGGCCCGCTTGTCTCGCGTGGCTATCTCAAGGACGAGGCAAAGACGGCAG
CTGCGTATATCGAGGATCCAGTTTGGGCTAGGCAGCTGGACAAGAGTGCCTCGCCTCGCCGGATGTACAAAACTG
GAGATTTGGCACGCTACGACGCCAACGGATATATGTTATTCTCCGGTCGTAAAGACAATCAGGTGAAGCTCCACG
GACAAAGAATGGAGCTGGACGAAGTGGAACACGCCATGTTAAGACACGAAAGAGTGCGCCAGGCTGTCGCGCGTA
TCCCTCGGCACGGACCACTCAAAGACAAGCTGGTGGCGATGTTGAGTCTCCATGATGTCTCATCGACCAGCTCCC
CCGTTGCAAACACAATTATTGTGCTTGATGAAGCCTCCCATGGTATTAAGGTTGGACAGGAACTTGCCTCCGTGC
GTAAGTTGCTGCAACAAAACCTACCAAGCTACATGGTACCAACGATTTGGATTGGTGTCGAGGCTGTTCCGCTGA
GCGCCAATTCGAAGGTTGATCGGAAATCCGTTGATGCTTGGATGGAAGAGATGGATCAGGAAACCTATACCTCGT
TGCTGCGCGATGGAGGTAGTGGTGAGAAAGAAGAAGAAATTCGCCGCCCATCCACCCCGGTGGAACAAATTCTGT
GCAACCTCATCAGCAAGATTCTTGGCTTGAGCTCGGAGACACTCAACCTCAACTCTTCGTTCCTGGCCCTTGGTG
GCGACTCCGTAGCTGCAATGCAGCTGCGTAGCAAGTCTCGCGCTGAGGGGGTTACGGTCTCCATGCTGGACATTA
TCAGGAGCAAGAGTCTCGTCGAGCTTGCGTCGAAGGCGGAATATACCGAACCAACTGTGAAGAAGGTCCAGGAAG
GGTCCTTTGATCTCTCGCCAATCCAGCAGATGTACTTCGATCTGGTGGGATCTGCTGCAGACGCAAACATTGGTC
ATTTCGACCAGAGCATTCTTCTGGAAGTCAACAGCGACGTGGCGCCTCAAACGTTGCGACAGGCCCTCGCACAGG
TTGTTCGGCGGCACTCGATGCTCCGCGCCCGATATGCTCGAAATGGTACCGGCCAGTGGTATCAGTACCTTGCTG
AAGATTCAGCAAATTCATTCCATTTCAGCGTCGAAGACGTGGAAGATGGTTATCAAGTGTCCAGAATACTGAGGA
ACATGGGTGGTGTGTTTGACATCGAGAAAGGCCCAGTCTTCGCTGCCCGCGTATACAATCTTCGTTCAGAGCGCA
AACAGTTGATGTTTGTTCATGCTCATCATTTGGTGGTGGATGTGGTTTCGTGGCACGTTCTGCTGGGCGATCTAG
AGCTTGCCATTGCCACTGGCAGCTTGGCCGGCCCAGCTCCGCTCTCTTTCCAGAGTTGGTTGCGTTCTCAAAAGG
ACATGGCGCAGTCTCTTGAACCACGAGAGCTGCTACCTTTCTCAAACACAAGCATGCCTGTGGCCAACTTTGAAT
ATTGGGGAATGGGAGGCAACAAGTCCAACAGATACTGCGACGCCGTCGTGACCGACTTTTGGCTCGATGAGTCCC
TAACTACCCAGTTAATGAGTGTCAGCAAGGGTACTTCAAGCGCTGCCCCTGTCGACATCATTCTGGCTTCTCTTC
TCCACTCCTTTGCGGCCGTCTTCCCTGACCGTTCCGCACCACCAGTCTTCTCTGAGGGCCATGGTCGCGAGTCAT
GGAACAACCAGGTCGATCCTTCCGGCACAGTGGGTTGGTTTACAACTATGAGCCCACTGCATGTATCTGATCTGC
AATTGGATATTATCAAGACCGTGCAGACCGTAAAGGATCTCCGTCGCCGGCTACCAGCTAACGGCATGTCATATT
TCAGCTCCAGGTATCTCTCCGACAAAGGGCGCAAAGCCTTTGGTTCTCATTTCGATATGGAGATCATGTTCAACT
ACCTTGGCCGGTCCTCTGAAGTTGGAAGTGAGAACGCCCTTCTCTCGCATGCCGAACTACCAGACGGCGCGACCT
TCGACCAATTGGTCCAAGATGAAAACCTTCCCCGCTGGTCTCTCTTCGACATCGTTGCCCTTGTCGTTGGCGGCA
GAACCCACGTTACCATGGCCTATAACAAGCACATGCAACACCAGGATAGAATCGTTGAGTGGGCAGCCAAGACAA
AGTCCACTCTGAGCCTTGCCATTGAGGTTCTCAGTGGGGTGAAAAGCCTGCCGCTCACTCCGCCAACCACTCCCA
AACCCTCACCCTTGCAGCACCAGCCCCAGGATCAATGCATCACCCTCGACAGCATTGAAGGAATTTACCCCTGTG
CCCCAGTACAGCGACACATGCTCGCAGAGCGCGAAAAGCACCCCAACCGCCGCTTGTACGAGATGGATTTTACTT
ACCAAGCTCATGCACTCAATGGTGTCGTCGACGTGGATAGAATCCGCGAAGCATGGCACCAGGTTGTGCAACGCC
ATCCCGCACTTCGAACTGTCTTCCTTCCCAGCATGTCTTCGCCCGGCTCCTACGACCAAGTTATCATTCGGAACT
GGCACCCCGAGGTCCCCTTTATCGAGTGCGCCAGTGAGGAGGAGATGACGGCTCGCATGGACGCCTACCGATCGG
TCAACTACAGCCTCTCGAATAGAAAGCCACACCATCAGCTCACCTTGTTCAGTACAACAGTCAATGGCGTGCAAA
AGGTTGCCTTCAAAACTGAAACAGACCACACCCTTACCGACGGCGTTTCTGTCGCTCTGATCCTCCGCGACCTGA
TGCTGGCGTATGAGGGCAAACTTCCCGCCACCCCAGCCCCGTCATTCGGTAGCTATTCTGTCTGGCTGAACGGGA
TGAGCCAAGGCGAGACACTAGTTAAGGACAAGGAATACTGGGTGGAGTTCGAGCGGAGCTCAGGGCCATCACTTA
TTCCTCATACCGATGCCTCCACCCTTGTACTATCCCAACCCCGGGTCCACAAAACAAAGACCATCAACCTGGATT
TGGAAACCACCAGCCGACTTCCTGCCTTCTGCGTGCAGCACGGTGTCACTATGGCGGCGTTCCTCCAGACGGCCT
GGGGAATGGTGTTACAGCACCTCACGGGATCTGACAAGACGCTCTTCTCCTTCATGACCGCCAACAGGGATGCGC
CGTTCGCCGGCGCAGCAGAGACCGTCGGTCCGCTCATCCAAATGCTTCTGTGTCGGATCGATCTCAGCAACAAGG
AGATTGGCGACGTGTTGAGGCAAGCACGAGATGACTTCCTTGAGTCGCTGGAGCATCAGTACGGACTGGCCCAGA
TGGAAGACGTGTGGCAGACCCCAGCGTGGAATTCTCTTATGAGTCTACAGTACATGGACTCGCGAGTGGGTCAGA
AGGCCACGGAGCGGACTGAACTGGAGGTTGAGCTGCGTTCGGCAGAAGATCCCACTGCGTGGGACGTGTCGATCG
GTGTGCAGATCCATAGTCGGGGAGACGGTGTTACTGAAGTGGATGCGGAGCTTGGCTATTGGTCTGATGTGCTCA
CGGATGAGCGGGCAGGAGATGTGAAGGATTTGTTTGAAGCATCTGTGAAGAAGATGCTTGATGGATGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail