Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4670.t1
Gene name
Locationscaffold_024:166942..182429
Strand-
Gene length (bp)15487
Transcript length (bp)15165
Coding sequence length (bp)15165
Protein length (aa) 5055

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.0E-75 225 616
PF00501 AMP-binding AMP-binding enzyme 1.4E-70 1327 1716
PF00501 AMP-binding AMP-binding enzyme 3.1E-71 2500 2894
PF00501 AMP-binding AMP-binding enzyme 9.5E-79 4003 4398
PF00668 Condensation Condensation domain 5.7E-43 868 1298
PF00668 Condensation Condensation domain 8.2E-46 2064 2479
PF00668 Condensation Condensation domain 4.6E-28 3123 3567
PF00668 Condensation Condensation domain 4.8E-46 3601 3983
PF00668 Condensation Condensation domain 1.5E-29 4645 5050
PF00550 PP-binding Phosphopantetheine attachment site 5.0E-07 762 821
PF00550 PP-binding Phosphopantetheine attachment site 8.9E-14 1862 1925
PF00550 PP-binding Phosphopantetheine attachment site 2.3E-13 3039 3102
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-09 4541 4601

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4670.t1
MSRFSCIFPTLTDGYVPNLDQTRAAGRRTYTIDRRGWTAPSSQTESHILAAWGLVLSSYVGTDEVAFYIVPTTGP
DTTALAELKVEGDMSRRSLINAAEQLLHPGPVGAGQVSGESANTIITFEKDIESLFVTQAEESFLSLHVHHDGQG
QVSLSLTYHLSLLTDAQAANVGTAMAQALAEVGADDHNRLIKNLNLMSPTHLESIWQFNANVPGMWEECFHDVIE
RRAANRPHSLAVDAWDMKLTYADLVREARLLAAYLQHRGVRPGSVVPISFERSGAALVAMLAVSKAGGAFVSVPP
TLPAGRLDAILEVIEAPFVVTWSKYEPFWAERLPTLPIDSYPKPSADATVKTLGKPEDLFYVIFTSGSTGRPKGC
MLSHSNWLNGALRNAPSWKYGPESRVLQMLSHTFDMSLLEICTSLGSGACVCVPRTEEIETSVSDAINRWQVNHV
IMTPSLARSLRRDDVPGLKTMCLGGEAFPREIVTMWSERINLWQFYGPSECSINSSSRPITRPDADPLNIGPPNS
AACWVVDTQDYNKLVPVGAIGELLVSGPIVGMGYLKNPIKTAEAFLDEVGFVAKDDPQFGGFRFYRTGDLVRWNS
DGTITFCGRADTQVKLNGQRLELAEVEYQLGLEAGVQYAIAMAPQSGRCKNNLIAVLTVKCGGASNQGNADDEIP
LLDRHDPIVQQTVKKLRSQLQHALPRYMVPTIWAFVGRMPMSPSGKIDRVQLRNWVQEMSQETFDAITGRSFEAE
DHVLGLSQLEQEIQLAWAEALGLSAAEVGLQQPFVALGGDSIKALDAVARCRARQIKISMVHILSCEGVREASSL
AEVQETPAHQVAEIAVDYSDLWTRLSTEYDISKLGVTQVEEVEDVFPCTTMQEGMFLGQIRRPGAYHMRFFHRVQ
LKGGSLPTVERIQQAWASLVERHPSLRTVFVDDLSSEAIYHSVVLRSVPMELTMREVPRDLNPESALAMFTEELV
PFRPNAPLHRMLLLTCRGRVPYLMLEISHVIMDGYALSVFRREFIRACSSTASLPRGPDYRMFANYHRTRQTDES
AKYWTNYLADCVPCHIPTDPLSVPTDASPEWPRTLQRRDFGFDNSVAFLQRCKERQATLACAIRAAWALVLRAYT
QSRDVCFGYVSSGRNVPVPEVETIFGLCLSMQVCRAKLSEASTIASLARKIQEDYVASLPFQHYPLAEAQRGLKQ
THGQGLFNTAISMEWVPPTAEDEDALLDLEEIREQDDPTEYDIAISVDIHEGHIKLGFLYWPNLSDFQITHLAEA
LQGAMNCFAFQPDVALNTLTLLQASDLCSTLTNGPTLLPLEAVRGNVISMIDRWVTRQPESPAIDGWDGSLTYKQ
LHEQSSWVARNLLHQGVKLGDRILVCADRSSRTVVTILGVVRAGCVLVLSNPTDPEKRLQWLAHKCNATLVVADP
AYEERFATSGARVFSTTSVCAPAAWDYEFSALDDQDLVSILFTSGSTGTPKGILMDHGALATSVLLGHGRTLRFS
RHTRMLHFASLTFDAALAEIFTTLAHGGCICVPCEEDRLSDVSGCISRFAVNTAMLTPSVGRLLDPEALPTLKAL
AMIGEPMSRLDVERFAPVLDLYNGAGPTETSIMVTIAGPMKPTDEPVNLGYAVAGVRLWVTEAENPNRLAPLGAV
GELIVEGRLVTRGYLDDPARTRESFLPNLPWLPSQHALYRTGDLVRYAEDGSLRYMGRKDTQVKLRGQRIELQEV
EYHLRKSLQQAQVVVEMVIPEGKIRAQASLVAFVSGLTAADVESSSARNFDQSMPMSQIALPGSTIQALEEALPR
YMIPSVYFALDTIPLSVNGKADRRRLREIGAALLVSSTAHKNTVDGKSEPVKWTASSKLELTLLELWTTTLGLEA
ETIYGDDSFFELGGDSVSAMKLVATARDRFKLSLSVPQMFRHPTIHQLAAILGEATGQPESSASSTTEEGFTFST
PDDSSTNDGVDDDFLRLATAQLAQLAQEKGKKVDIAALLKQLQGGSSSCKTPSVSSSSSSSSSRKKKSAKVVSPV
EAPAPVPVPFSLLDGGADVVEKIRAQAVEQCKILPGDIEDIYPATALQEGMMALMARTPGVYTTTLTCELPERVN
LARLHSAWDKAAEAHPILRTRIILTENNTAVQVVQRAKELPWDAYSLQDGDPLPDLTSNMTLGSTLLRLAEIHRQ
NQPRMLLVAIHHALYDGWSMPLLKQAVEDVYHGQELWPQPFTPFINYLNEGKPAAQGYWTAHLDGFAGSVFPNLP
SINHHIQPTERRTRSLAVPTAPPGSQYTMATKIQAAWAVTVSRYAEAEDIVFGTVSTGRSAPVPSIDRMVGPTIT
TVPVRISLGNQAERLTSLLQRVQEDGWNRMDHEHLGLQHIRRLGESAAAACNLQTLLVIQPREEPRAKSISTLLS
GLQDVAELKGVDTYPLMLVCEPDGVSLHLTAVFDPAVLDAVMLDRMLAHWELVLNQIWSEPDMAVMGLDGVSYRD
KQTLVRWNAGEKIADGCAHDAVYEWSVRTPHAPAVFAWDGKWTYEELEKCSSLIASQVLVHGVSSGDFVALYHEK
SRWAAAAILAVFKAGGILVTLDPAHPKDRIKDILDQARPRLVLTSQSLLDEARELETPVMVVQFAASQPMPGECF
PLPTVSPTQAAYAPFTSGSTGRPKGIPLEHRGLAASTASVARACLLRPASRVLHFASFAFDASMMEHLIAWHAGS
CLCIPVETVRQTDLARCIRDFEVTWAFLTPSCLRLISPDDVQSLEALGLGGESMTPEDIFIWGPRLRQIVQLYGP
AECSIVAALTEVTKPSENRLIGRPNACRCWVVDPHSPDRLAPLGAVGELVIEGITVGRGYIDDPERTTQAFIPPP
TWIQTLYPNEQQPSRLYRTGDLVRYAGTDGKLTFIGRRDGQLKLHGQRIELADVEAHLRPLIPGTQKVVVEMVHS
VGNHHPLLAAFVEEILTSQDQVEQVVNLLHPSQTQCALNVKAIDSALSQTVPQYMIPSMYLHISRLPLSASGKLN
RRHLRRLVAEFPRQRLSEYAAGSGLAVPNRPATAQEREMQAIWARVLSVDPDTIGVNEDFFRIGGDSISGMQVAT
RCNAAGMHITSADLFQHRTIEQLMRHLSANGKTGSASISLPPEPVDEWVPLAPIQQLFFEIAPQGPDHFNQSLLL
RTSRRVSAEKLAGGLDILVGRHSMLRARFCRDDSGQWSQQVRSRGPYPASAFYRLTTHNHIAPELLSSLLAASQM
ALSIQEGPLLAVDLVNLTDDTQLVYLVAHHLIIDLVSWRILHAELEEYLQTGSFASTTGSVPFLTWSRAQAEYSA
NHLTPTLPLPGFQEANDGFDASRYWGISCESNTFGQTSTSTFTLDQTVTDQLFGPANNVLDTRPAEILQAALWYS
FTQSLTDRPGPSIYVEGHGREPWTGSIDLSGTVGWFTTMSPLVSAPWDSLSQTSMRDFLDALSYIKDQRRRIPAN
GWAYFTSRYLNDEGKVAYGRMKPVVEILFNYMGQYQEMNREDAILQLAGDGIQSGTGAADVADNVPRFSLIDVSA
FISNGCLTFQFILPKSLQQDSRLQGCFQEYERTLVAAANSLSTEGPRKTLADFPLMPALTYDQLSQCLDHTLPSM
DRLTLEKLKDAWTEVINRHDILRTLLLPVSDYSHLDQVVMAPGSLQHLVRINAMDTNPTQGLPHSINITSDSTGT
VICEWNVSHALVDAMSIAVIQQEVNEALEGSLGQHQKTPRYADYIQWLSLQDNTETQAYWKKYLEGVEPCLFPKL
ASSTDKVNPEGTISAIRATWTRDSRLDKLCHTHGITLTNLFHIVWSLLLSAYLGTDKVCFGYTTLGRDVPVDGVE
KMVGPLVNVIATTIQLQEDDSILDALLTHQTHLSNSLQHQHYALADVYASLGLVGSQLFNTIVSLQDISHFDAND
ERPTRVEMLPANDVSEYDVALNIGVDQSSIQVVCSYRTLSLSVEQADALLRTTSHVLDEILRDPKQPLRDLEVIS
PQCKEQLVKWNAAMPAPTDEYIHEKIQDQCRLHSSREAACAWDGIFTFAEVDDLSSRLAARLIRMGVTSGHIIPI
YSPKSRWTVIAILGVLKTGAAFTLLETSHPTARLRVICNEIKADIIIAPASHAVPAATLAPILVVLDSITSMSPQ
ESDLLPAVGMPPAAEALAYLIFTSGSTGNPKGVMVTHQNLCSNASIMTTSVNMTSDSRVLHFASHAFDACLWEIF
GALFAGACLIIPSESETKEDLAGCIERMVVTWAFLTPSVARILKPEALPSLRNLVLGGEPIAASDLDMWRGHVQV
VCAYGPTETAILASTTSPSTFPSDGKDIGVPTGSSLWIVDKQNYNKLAPHGATGELLIEGPNVSQGYLGDPEKTN
EAFPVAPRWLSQLRKSPTRVYRTGDLVRFNTSTGTIHFVGRKDNQIKFHGQRIELGDIEHHAQQAFSNASMVIVD
LITPEQPQQPYIVAFVHQADTRTGTADPIDTILLPPSESFRADAIGAQNHMHKRLPHYMVPTAFLPLHRLPLSGT
GKADRKRLRQCALSLSSLELNAYRATASAKRMPFTAAECKMQELVATVLGRDMSEIGMDDSFFYLGGDSIQAMRL
VSEGRQQGLTLSLQAIFDAPRLGDLAYRTANLVRVSEPAPPTLPATSSDDCDHKETIVAALPIKKTDVAEVLPTT
SFQRTWLDSQLKSYIVVDIPGPIDLARLRTAIQRVVKAHPILRASFVPYETTTMQVILRTAVVITEADLSTTTVE
GICRKDANAPMAPGTPYLRVILATQGEVDRKLIMRLSHAQYDGISLSLLMNDLSHAYASESRPLPSSHLPAFNDY
ITYQQTQGADPTATTFWHRLLKDVPITYLDLQPAETPTSNGSLITRTRDINIAAFPSLPNGITTATAVKAAWSLV
LAQKTGSLAVIFGQVVHGRGIALTGVEGIVGPCANITPVVARLGPQTTRMELMQTLQDQHRSAMPYETVSLDDAL
AYTKDSQAGRKELQTIVQHQNNVMADDMELSLGEARCRVDLRAVDHVPQEVWVYSSIDGGRPGMLEVKIMSSTLV
LSEEVAEELMDLLVEMMKRLFSDPEGVCV*
Coding >Ani_SJS100_1|g4670.t1
ATGAGTCGCTTTTCTTGCATCTTCCCTACCCTAACGGATGGGTATGTCCCAAATCTAGATCAAACTCGTGCCGCA
GGTCGGCGAACATACACGATCGACCGGAGAGGATGGACCGCCCCAAGCAGTCAGACAGAATCGCACATCCTAGCA
GCCTGGGGCCTTGTTCTATCCAGCTACGTAGGCACCGATGAAGTGGCTTTCTACATTGTGCCAACGACTGGTCCG
GACACAACAGCATTGGCTGAATTGAAGGTCGAGGGAGACATGTCTCGCCGGTCCCTCATCAACGCTGCCGAGCAG
TTGTTGCACCCAGGACCCGTGGGTGCCGGCCAGGTGTCTGGGGAGTCTGCCAATACGATAATCACCTTTGAGAAG
GATATTGAGTCGTTATTTGTTACTCAGGCCGAGGAGTCCTTCCTATCGTTACATGTTCATCATGATGGGCAAGGG
CAGGTCTCTCTTTCTCTTACCTACCACCTATCGCTCTTGACCGACGCGCAGGCAGCAAATGTGGGCACTGCGATG
GCCCAGGCGCTCGCCGAGGTGGGGGCAGACGACCACAATAGGTTAATCAAGAACCTCAATCTCATGAGCCCGACA
CACCTGGAAAGCATCTGGCAGTTTAATGCCAATGTTCCCGGTATGTGGGAGGAGTGCTTTCATGATGTGATTGAG
CGTCGCGCCGCGAATCGCCCACACTCCCTGGCGGTCGATGCCTGGGATATGAAGCTCACCTACGCCGACCTCGTA
AGGGAGGCACGTCTGCTCGCCGCATACCTGCAGCACCGCGGCGTGCGTCCAGGATCCGTGGTCCCCATTTCATTC
GAACGGTCGGGAGCAGCTCTGGTTGCCATGCTGGCTGTGTCCAAGGCCGGCGGAGCCTTTGTCAGTGTGCCACCG
ACTCTCCCTGCTGGACGACTCGACGCCATTCTGGAAGTCATCGAAGCACCGTTTGTGGTAACTTGGTCGAAGTAC
GAACCATTCTGGGCCGAACGCCTCCCTACGCTCCCTATAGACAGCTATCCCAAGCCATCTGCAGATGCGACGGTG
AAAACCCTCGGAAAGCCCGAGGACCTTTTCTATGTAATTTTCACTAGCGGTTCGACAGGCCGGCCGAAAGGCTGC
ATGCTGTCCCACTCGAACTGGCTGAACGGCGCGCTTCGTAACGCTCCTAGTTGGAAGTATGGTCCCGAGAGCCGT
GTCCTGCAAATGCTGAGCCACACCTTCGACATGAGTCTGCTGGAGATCTGCACCAGTCTGGGATCCGGGGCCTGC
GTGTGTGTGCCACGCACAGAGGAAATCGAAACCAGCGTCTCCGATGCCATCAACAGGTGGCAGGTTAATCATGTT
ATCATGACACCTTCACTTGCCCGCTCCTTGAGACGCGACGACGTGCCCGGGCTGAAGACAATGTGCCTTGGTGGT
GAAGCCTTCCCCAGGGAGATTGTCACCATGTGGTCCGAGCGGATTAATCTGTGGCAATTCTACGGCCCCAGCGAG
TGCTCAATTAACTCGTCATCGCGGCCAATCACACGGCCCGATGCGGATCCGTTGAATATCGGTCCTCCCAACTCG
GCTGCTTGCTGGGTAGTAGATACTCAAGATTACAATAAACTGGTTCCCGTTGGTGCTATTGGAGAGCTACTTGTT
TCTGGACCTATTGTCGGCATGGGATATCTCAAAAATCCCATTAAGACAGCCGAGGCTTTCCTTGATGAAGTCGGG
TTCGTGGCGAAGGATGATCCCCAGTTTGGTGGATTCCGGTTTTACCGAACAGGTGATCTCGTGCGGTGGAACTCG
GACGGTACTATCACTTTCTGCGGCCGTGCTGATACGCAAGTCAAGCTTAATGGCCAGCGACTTGAACTGGCCGAG
GTGGAATATCAGCTGGGGCTGGAAGCTGGCGTTCAGTATGCCATTGCAATGGCACCTCAATCTGGTCGGTGCAAG
AACAATCTGATTGCTGTTCTCACCGTCAAGTGCGGCGGCGCTAGCAACCAGGGTAATGCTGACGACGAAATCCCA
CTGCTGGACCGCCACGATCCGATTGTCCAGCAGACCGTTAAGAAGCTGCGTTCGCAACTTCAGCACGCTCTGCCG
CGGTATATGGTGCCCACCATCTGGGCGTTCGTTGGGCGCATGCCCATGTCACCGTCTGGCAAGATTGATCGCGTA
CAACTGAGGAACTGGGTGCAAGAGATGAGCCAGGAGACGTTCGACGCAATCACCGGTCGAAGTTTCGAGGCGGAA
GATCATGTTCTCGGCCTCAGCCAGCTAGAGCAGGAGATCCAGCTCGCCTGGGCCGAAGCTCTGGGTCTCTCCGCC
GCTGAGGTGGGCTTGCAGCAGCCATTTGTCGCGCTAGGCGGGGATTCCATCAAGGCCCTCGATGCCGTAGCTAGA
TGTCGGGCTCGTCAGATCAAGATTAGCATGGTGCATATCTTGTCTTGCGAAGGCGTCCGAGAGGCTTCCTCGCTG
GCAGAAGTGCAGGAGACCCCTGCTCATCAGGTGGCCGAGATCGCGGTGGATTACTCGGATCTGTGGACCCGTCTG
TCCACTGAATATGACATTAGCAAGCTGGGCGTCACGCAGGTTGAAGAGGTGGAGGATGTCTTCCCCTGCACAACC
ATGCAAGAGGGCATGTTCCTCGGCCAGATCCGTCGGCCTGGAGCCTACCACATGCGTTTTTTCCACCGCGTTCAG
CTGAAGGGTGGTTCCCTACCGACCGTTGAACGCATCCAGCAGGCCTGGGCCTCCCTTGTCGAGAGACATCCTTCA
TTACGCACAGTCTTCGTGGATGATCTGTCCTCAGAGGCCATTTATCATTCGGTCGTGCTGCGGTCCGTGCCGATG
GAGCTTACAATGCGTGAGGTGCCGCGAGACCTCAACCCCGAATCGGCCCTCGCTATGTTCACGGAGGAGCTCGTG
CCCTTTCGTCCTAATGCCCCATTACATCGCATGCTTCTGCTGACCTGCCGCGGACGCGTCCCATATCTTATGCTG
GAAATTTCTCACGTCATCATGGACGGCTATGCGCTGTCGGTTTTCCGACGCGAGTTCATCCGCGCCTGCTCCTCC
ACTGCCTCCCTGCCGCGAGGCCCAGACTACCGCATGTTTGCCAACTACCATCGCACACGACAAACCGACGAGAGT
GCAAAGTATTGGACAAATTACCTAGCCGACTGTGTGCCATGCCACATCCCTACGGATCCGTTGAGTGTGCCGACG
GATGCCTCCCCTGAATGGCCTCGGACGCTGCAGCGCCGCGACTTTGGCTTCGACAACAGCGTAGCGTTCCTGCAG
CGATGCAAAGAGCGCCAGGCTACACTCGCTTGTGCGATCCGCGCTGCCTGGGCGCTGGTGCTACGCGCCTACACC
CAATCACGGGATGTTTGCTTCGGCTACGTCTCCTCCGGGCGCAACGTGCCGGTGCCCGAGGTCGAGACTATTTTT
GGTTTGTGTCTCAGTATGCAGGTCTGTCGCGCAAAGCTAAGCGAGGCTTCCACAATCGCTAGCCTCGCTAGGAAG
ATCCAGGAGGATTATGTTGCTAGCTTGCCATTCCAGCACTACCCATTGGCAGAGGCACAACGCGGGCTGAAGCAA
ACACATGGACAGGGGCTGTTCAACACGGCGATCTCCATGGAATGGGTGCCTCCGACAGCGGAGGATGAGGATGCC
TTGCTGGATTTGGAGGAGATTCGTGAACAGGATGACCCGACTGAGTACGACATCGCCATCAGTGTGGATATCCAC
GAAGGCCACATCAAACTGGGCTTCCTCTATTGGCCCAACTTGAGCGACTTCCAGATTACCCATCTCGCCGAGGCC
CTCCAGGGTGCCATGAACTGCTTTGCCTTTCAGCCAGACGTGGCCCTGAACACTCTCACTCTTCTGCAGGCCAGT
GATTTGTGCTCCACCCTAACTAACGGACCTACCCTGCTGCCTCTAGAAGCCGTCCGCGGCAACGTGATATCGATG
ATAGACCGCTGGGTGACCCGCCAGCCGGAGAGCCCTGCCATCGACGGCTGGGATGGATCCCTGACCTACAAGCAA
CTGCACGAGCAATCCTCCTGGGTGGCTCGCAATCTGCTTCATCAAGGGGTAAAATTGGGAGACCGCATCCTGGTG
TGTGCAGACCGGTCAAGTCGCACTGTGGTAACAATTCTAGGCGTCGTGCGGGCAGGATGCGTGCTGGTGCTCTCG
AACCCGACGGACCCGGAAAAGCGCCTGCAGTGGCTGGCACACAAGTGCAATGCTACCCTGGTCGTTGCTGATCCT
GCATACGAAGAGCGGTTTGCGACTTCCGGTGCTCGTGTATTTTCAACAACCTCCGTTTGTGCCCCCGCAGCCTGG
GACTACGAGTTCTCAGCTCTGGACGATCAGGACCTTGTCAGCATCCTCTTTACCTCCGGCAGCACCGGCACCCCG
AAAGGCATATTGATGGACCATGGGGCACTCGCGACCAGTGTTCTCCTGGGCCATGGCCGCACGTTACGCTTCTCA
CGCCACACCCGCATGCTGCATTTTGCCTCCCTAACTTTTGACGCCGCTCTGGCGGAGATCTTTACCACCTTGGCA
CATGGTGGGTGTATCTGCGTGCCGTGTGAGGAAGACCGTCTCTCTGACGTGTCGGGTTGTATCTCCCGCTTTGCG
GTCAACACCGCTATGCTGACACCCTCCGTCGGGCGGCTGCTGGATCCCGAGGCTCTGCCAACGCTGAAGGCTCTG
GCCATGATCGGCGAACCGATGTCCCGGTTGGATGTTGAGCGGTTCGCCCCGGTACTTGACCTCTACAATGGTGCA
GGACCTACGGAAACATCCATAATGGTAACAATTGCCGGGCCGATGAAACCGACTGATGAGCCAGTGAATCTGGGT
TATGCCGTGGCCGGCGTTAGGCTGTGGGTGACTGAGGCTGAGAACCCTAATCGCCTGGCTCCGTTGGGAGCAGTC
GGAGAGTTGATCGTCGAGGGCCGCTTGGTCACTCGCGGATACCTGGATGATCCAGCACGCACTAGGGAGTCTTTC
CTTCCCAATTTACCATGGCTTCCGTCTCAGCATGCCTTGTACCGAACAGGCGATTTGGTGCGCTATGCGGAAGAT
GGCAGCTTGCGGTATATGGGACGGAAGGACACGCAGGTCAAGTTGCGTGGACAACGCATTGAGCTACAAGAGGTC
GAGTATCATCTGCGAAAGAGCTTACAGCAGGCACAGGTTGTGGTGGAGATGGTCATTCCAGAGGGGAAAATTCGT
GCTCAGGCAAGCTTAGTGGCTTTTGTCAGTGGTTTGACAGCGGCAGATGTTGAGTCGTCTTCGGCGCGTAACTTT
GACCAGTCGATGCCCATGTCACAAATCGCCTTGCCCGGCAGTACGATCCAAGCGCTTGAGGAAGCCCTGCCTCGC
TATATGATCCCGTCGGTGTATTTCGCCCTGGACACGATCCCGCTCTCAGTCAACGGCAAGGCAGATCGGCGAAGA
CTGCGTGAGATAGGTGCCGCGCTGCTGGTATCCAGTACCGCCCATAAGAACACTGTTGATGGAAAGAGCGAGCCT
GTCAAATGGACAGCATCTTCGAAATTGGAGCTGACACTGTTGGAATTGTGGACTACGACACTTGGACTTGAGGCT
GAAACAATCTATGGCGATGATAGCTTCTTTGAATTAGGCGGCGACTCTGTTTCTGCCATGAAGCTGGTGGCCACG
GCTCGGGATAGATTCAAGCTGTCGTTGAGTGTTCCTCAAATGTTCAGACACCCCACTATTCATCAGCTTGCCGCC
ATACTTGGGGAGGCCACTGGGCAGCCAGAAAGCTCAGCTTCGTCCACGACTGAGGAAGGATTCACATTCAGCACG
CCAGATGACTCCTCCACCAATGACGGGGTCGATGACGATTTTCTACGGCTGGCCACCGCTCAGCTTGCCCAACTG
GCGCAAGAGAAGGGTAAGAAGGTGGATATTGCTGCTCTTCTAAAGCAGCTGCAAGGCGGTTCCTCTTCCTGTAAG
ACCCCATCCGTGTCTTCCTCCTCATCATCGTCGTCGTCGAGGAAGAAGAAGTCAGCCAAAGTGGTGTCCCCAGTC
GAAGCACCTGCTCCTGTCCCAGTGCCATTTTCCTTGTTGGATGGCGGCGCTGATGTTGTAGAGAAGATTCGTGCA
CAGGCCGTGGAGCAGTGCAAGATCCTACCCGGGGATATTGAAGATATTTATCCCGCCACCGCTCTACAGGAGGGG
ATGATGGCGCTGATGGCCAGGACACCCGGGGTTTATACAACAACTTTAACATGTGAGCTCCCTGAGCGGGTTAAT
CTTGCACGGCTGCACTCCGCATGGGATAAAGCTGCCGAGGCGCATCCAATTTTGCGGACGCGGATTATCCTCACC
GAAAACAACACGGCAGTGCAGGTTGTGCAGCGTGCGAAAGAGCTTCCATGGGATGCCTATTCCCTTCAGGATGGC
GACCCTCTGCCAGACCTAACGTCGAACATGACCCTTGGTTCTACCCTTCTGCGCCTAGCTGAGATACACCGGCAA
AACCAGCCTCGGATGCTGCTGGTGGCCATTCATCACGCTCTCTACGACGGATGGTCAATGCCACTGCTCAAACAG
GCAGTTGAGGATGTCTATCATGGACAGGAGTTGTGGCCACAGCCCTTCACCCCATTCATTAATTACCTAAATGAG
GGAAAGCCGGCGGCACAAGGCTACTGGACCGCCCACCTGGACGGCTTCGCAGGAAGCGTCTTCCCTAATTTGCCT
AGCATAAACCACCATATCCAGCCGACGGAGCGTCGAACCCGCTCACTGGCCGTGCCGACAGCGCCCCCCGGATCG
CAGTATACTATGGCGACAAAAATCCAAGCAGCGTGGGCTGTCACGGTTTCGCGATATGCAGAGGCTGAGGACATT
GTCTTTGGTACCGTTAGTACCGGTCGTTCGGCACCTGTGCCGTCGATTGATCGCATGGTCGGTCCCACCATCACG
ACTGTGCCTGTTCGCATCTCGCTCGGCAACCAGGCAGAGCGTCTCACCTCACTGCTGCAGAGGGTCCAAGAGGAT
GGCTGGAACAGGATGGATCATGAACACCTGGGCCTCCAGCACATCCGCCGTCTCGGTGAATCTGCTGCTGCTGCT
TGTAACCTCCAGACGCTGTTAGTAATTCAGCCTCGTGAAGAGCCTCGTGCCAAATCCATTTCCACCTTACTTTCA
GGATTGCAAGACGTGGCTGAACTCAAGGGCGTGGATACGTATCCGCTAATGTTGGTGTGCGAGCCTGATGGTGTC
AGTCTGCATTTGACTGCCGTGTTTGATCCAGCCGTCCTGGACGCAGTCATGCTGGACCGGATGCTTGCTCATTGG
GAGCTCGTTCTAAATCAAATATGGAGTGAGCCGGACATGGCAGTGATGGGGCTTGATGGCGTATCATACAGGGAT
AAGCAGACATTGGTAAGATGGAATGCTGGAGAAAAGATTGCTGATGGATGTGCCCATGACGCGGTGTATGAGTGG
AGTGTCCGCACCCCTCATGCACCCGCTGTCTTCGCTTGGGATGGTAAATGGACCTACGAGGAACTGGAGAAGTGC
TCCTCTCTCATAGCCAGTCAGGTCCTAGTCCATGGTGTCTCCTCCGGAGACTTTGTTGCTCTTTACCACGAGAAG
TCTCGATGGGCGGCGGCCGCAATTCTCGCGGTGTTCAAAGCCGGCGGCATCCTGGTTACCTTGGACCCGGCCCAT
CCCAAAGACAGAATCAAGGATATCCTGGATCAAGCACGGCCGCGACTCGTACTGACCTCTCAGTCTCTCCTCGAT
GAGGCTAGAGAACTTGAGACCCCGGTCATGGTTGTACAGTTCGCAGCATCCCAACCAATGCCCGGAGAATGCTTC
CCTCTACCCACAGTAAGCCCCACCCAGGCTGCATATGCTCCGTTTACCTCTGGATCTACAGGTCGACCAAAAGGG
ATTCCATTAGAGCATCGGGGACTGGCTGCTTCAACTGCTTCAGTAGCTCGTGCCTGCCTACTGCGCCCAGCATCC
CGAGTCCTTCATTTTGCCAGCTTCGCCTTTGATGCCAGTATGATGGAGCACCTGATAGCCTGGCACGCCGGCAGC
TGTCTCTGTATCCCGGTTGAAACTGTCAGGCAGACGGATCTGGCCAGGTGCATACGAGACTTCGAAGTTACTTGG
GCTTTTCTCACACCTTCATGCCTACGGCTAATCTCCCCCGATGATGTTCAGTCCCTTGAAGCCCTGGGTCTAGGT
GGTGAGTCTATGACGCCCGAGGATATTTTCATCTGGGGTCCGCGACTCCGCCAGATTGTCCAGCTATACGGCCCG
GCGGAGTGTTCCATTGTGGCCGCGTTGACAGAAGTTACCAAGCCATCGGAGAACCGATTGATAGGGAGACCCAAT
GCCTGTCGATGCTGGGTAGTTGACCCACACAGCCCAGATCGCCTAGCGCCCCTAGGTGCTGTCGGAGAGCTGGTA
ATTGAGGGGATCACTGTCGGTCGGGGTTATATTGACGATCCCGAGCGAACCACCCAAGCATTTATACCACCCCCT
ACATGGATTCAAACACTGTATCCGAATGAGCAACAGCCAAGTCGCCTCTATCGGACCGGTGATCTCGTACGGTAT
GCTGGTACGGACGGGAAGCTGACCTTCATCGGGCGAAGGGACGGCCAACTCAAGCTTCACGGACAACGTATAGAG
TTGGCGGACGTCGAAGCTCACCTCCGTCCTCTAATACCCGGCACGCAGAAGGTTGTTGTAGAGATGGTTCACAGT
GTGGGCAACCACCACCCCCTTTTAGCTGCCTTTGTGGAAGAAATATTGACATCACAAGATCAAGTGGAGCAAGTG
GTTAATCTATTGCACCCAAGTCAAACCCAATGTGCCCTGAATGTCAAGGCCATCGATAGTGCACTGTCCCAAACG
GTTCCCCAATACATGATTCCTAGCATGTATCTACATATCTCCCGCCTGCCCCTAAGCGCATCTGGAAAGCTCAAC
CGTCGCCACCTGCGTAGGTTGGTCGCAGAGTTTCCACGTCAGAGACTCAGTGAATACGCTGCTGGATCAGGCCTC
GCAGTCCCGAACCGGCCGGCAACAGCTCAGGAGCGTGAAATGCAGGCTATCTGGGCGCGAGTATTGTCAGTTGAC
CCGGACACAATCGGAGTCAACGAAGACTTTTTCCGCATCGGCGGCGACTCCATTTCCGGGATGCAGGTTGCCACG
AGATGCAATGCGGCAGGCATGCATATCACCAGTGCGGATCTCTTCCAACACCGTACCATCGAGCAACTGATGCGC
CATCTTAGTGCTAATGGAAAGACTGGCTCCGCGTCAATCTCACTACCTCCAGAGCCGGTGGACGAGTGGGTTCCT
CTTGCCCCCATCCAGCAACTCTTCTTCGAAATCGCCCCACAGGGTCCAGATCACTTCAACCAGAGCCTGCTCCTG
CGCACTAGCCGCCGGGTCAGTGCAGAAAAACTCGCCGGAGGCCTAGATATTCTCGTGGGACGACATTCTATGCTA
CGCGCGAGATTTTGTCGCGATGATTCCGGCCAATGGTCCCAGCAGGTAAGGTCGCGCGGCCCGTACCCTGCTAGT
GCATTTTACCGGTTGACCACACACAACCACATCGCTCCTGAGTTGCTGTCGTCACTTCTTGCTGCGTCTCAGATG
GCCTTGTCTATTCAAGAGGGGCCGCTCTTAGCCGTTGATCTGGTGAATTTGACGGACGATACTCAGCTCGTCTAC
TTGGTGGCCCATCATCTCATTATCGACCTGGTCTCGTGGCGCATCTTGCACGCGGAATTGGAGGAATATCTGCAG
ACGGGCTCCTTCGCGTCCACCACAGGCTCTGTCCCCTTCTTGACCTGGAGTCGAGCACAGGCCGAATACAGCGCT
AATCACCTTACTCCCACACTTCCTCTACCTGGCTTCCAGGAAGCAAACGATGGCTTCGATGCCTCGAGGTACTGG
GGGATTTCTTGCGAGTCGAACACATTCGGGCAAACCTCCACTTCCACGTTCACCTTGGACCAGACTGTGACCGAC
CAACTCTTCGGCCCCGCTAACAACGTGCTTGATACTCGACCAGCTGAAATTTTGCAAGCTGCCCTCTGGTACTCT
TTCACTCAATCTCTCACCGACCGTCCGGGTCCCAGCATCTACGTTGAAGGTCACGGGCGAGAACCGTGGACGGGT
TCCATTGACCTTTCGGGAACGGTCGGTTGGTTTACAACCATGTCTCCGCTAGTGTCCGCTCCGTGGGATAGCCTA
TCACAGACATCGATGCGGGACTTCCTCGATGCGCTCAGCTATATCAAGGACCAGCGCCGACGCATTCCGGCTAAC
GGATGGGCGTACTTCACCTCACGATATTTGAACGACGAAGGCAAGGTCGCGTATGGGCGCATGAAGCCGGTCGTG
GAAATTCTGTTTAACTATATGGGCCAGTACCAGGAGATGAACCGTGAGGACGCCATACTACAGCTGGCTGGCGAT
GGCATCCAGTCCGGTACCGGTGCTGCAGACGTTGCGGACAACGTACCACGCTTTTCGTTGATCGACGTTAGCGCG
TTCATCTCGAACGGATGTCTAACCTTCCAGTTTATACTCCCTAAATCTTTGCAGCAGGACTCTCGACTGCAAGGG
TGTTTTCAGGAATATGAACGCACTCTCGTCGCCGCTGCTAATTCACTGTCAACTGAGGGCCCCCGCAAAACATTG
GCCGACTTTCCCCTTATGCCTGCACTCACATACGATCAGCTAAGCCAGTGCCTTGATCATACGCTGCCTTCGATG
GACCGACTCACATTAGAAAAGCTGAAGGACGCTTGGACTGAAGTGATCAACCGGCATGACATCCTCCGTACTCTC
CTTCTACCAGTTTCGGATTACAGCCACTTGGACCAAGTAGTCATGGCCCCTGGCAGTCTTCAACATCTGGTTCGG
ATTAATGCGATGGACACCAATCCCACACAGGGCCTACCACACTCGATTAACATCACCAGCGACTCAACCGGCACT
GTAATTTGCGAGTGGAATGTCAGTCACGCCTTGGTCGATGCCATGTCGATTGCGGTCATTCAACAGGAGGTCAAT
GAGGCGCTGGAAGGGTCGCTGGGTCAGCATCAAAAAACACCGCGATACGCAGATTACATCCAATGGCTTTCTCTG
CAAGACAACACCGAGACACAGGCGTATTGGAAAAAGTACCTCGAGGGAGTGGAGCCATGTCTCTTTCCAAAATTG
GCTTCTTCGACTGACAAAGTCAACCCGGAAGGTACCATTTCTGCCATTCGTGCCACCTGGACCCGCGATTCGCGG
TTGGACAAGCTATGCCATACGCACGGTATCACATTGACAAACCTATTCCACATTGTCTGGTCCCTTCTTCTCAGC
GCCTATCTAGGCACTGATAAGGTTTGCTTCGGCTATACGACCCTTGGTCGAGATGTGCCTGTCGACGGGGTAGAG
AAGATGGTCGGCCCTCTAGTCAATGTTATTGCCACAACCATCCAACTTCAAGAGGACGATTCGATCTTGGATGCA
CTTCTCACTCATCAAACCCATCTCTCAAATAGTCTCCAACACCAGCATTATGCGTTGGCAGACGTGTATGCCTCT
TTAGGTCTGGTCGGTTCTCAGCTGTTCAACACTATCGTGTCTTTGCAGGATATATCTCACTTCGATGCCAACGAC
GAGCGGCCGACCAGGGTCGAAATGCTCCCTGCAAATGACGTCTCAGAGTATGATGTGGCTCTCAATATCGGTGTC
GATCAATCTTCCATTCAAGTGGTCTGCAGCTACCGAACACTATCGCTGTCTGTGGAGCAGGCCGACGCGCTACTG
CGAACTACCTCCCATGTACTGGATGAAATCCTGAGGGATCCCAAGCAACCGCTTCGGGACCTTGAGGTGATTAGC
CCCCAGTGTAAAGAGCAACTCGTAAAGTGGAACGCTGCCATGCCTGCCCCGACCGATGAATACATCCATGAGAAG
ATTCAGGACCAATGCCGTCTCCACTCTTCCCGAGAAGCCGCTTGCGCCTGGGACGGCATATTTACGTTCGCTGAA
GTTGACGACCTATCGTCACGTCTGGCAGCACGGCTTATTAGGATGGGGGTTACCTCCGGTCACATCATACCAATC
TACTCACCCAAATCCCGATGGACGGTCATCGCCATTCTAGGAGTCCTAAAAACTGGGGCTGCCTTCACACTTCTA
GAAACATCGCATCCGACGGCTCGACTGCGCGTTATATGCAATGAGATCAAGGCTGATATAATAATCGCGCCAGCA
TCGCATGCCGTCCCAGCGGCAACTTTGGCTCCTATCCTAGTCGTGCTCGACAGCATCACGTCGATGAGCCCCCAA
GAATCAGATCTCTTACCAGCTGTGGGTATGCCACCGGCTGCAGAAGCTCTCGCCTATCTCATCTTCACTTCAGGC
TCCACAGGAAACCCCAAGGGGGTTATGGTCACTCATCAGAATTTGTGCAGTAATGCGTCTATAATGACAACATCT
GTCAATATGACATCCGACAGCAGGGTGCTACATTTTGCATCCCATGCATTCGATGCGTGTCTTTGGGAAATATTT
GGTGCCCTATTTGCCGGTGCTTGTCTGATCATCCCGTCCGAGTCAGAGACCAAGGAAGATCTGGCTGGTTGTATC
GAGCGCATGGTCGTCACTTGGGCATTTCTGACCCCTTCCGTCGCAAGGATCTTAAAGCCAGAGGCCCTTCCCAGT
CTCCGTAATTTAGTCCTGGGAGGCGAGCCGATAGCGGCCTCGGATTTAGATATGTGGCGGGGTCACGTACAGGTT
GTGTGTGCCTATGGACCAACCGAAACCGCCATCCTCGCCAGTACGACCTCACCCTCTACCTTTCCCAGCGATGGC
AAGGATATCGGCGTGCCAACTGGTAGCTCCCTTTGGATTGTTGACAAGCAAAATTACAACAAGCTGGCACCTCAT
GGAGCCACAGGCGAGCTGCTGATTGAGGGCCCCAATGTGAGCCAAGGATATCTTGGGGATCCAGAGAAAACCAAT
GAAGCCTTCCCAGTCGCTCCACGCTGGCTGTCACAGCTCCGAAAGTCGCCTACCAGGGTCTACCGAACTGGTGAC
TTGGTTCGCTTCAACACATCTACGGGCACCATTCACTTCGTTGGACGCAAGGATAACCAGATCAAGTTCCACGGA
CAGCGCATCGAGCTCGGTGACATCGAACATCATGCTCAGCAGGCCTTTTCGAATGCCAGCATGGTCATCGTCGAT
TTGATTACCCCTGAACAGCCTCAACAACCATATATTGTTGCTTTCGTACATCAAGCAGATACAAGGACTGGAACG
GCCGACCCAATTGACACCATCTTGCTTCCTCCCTCCGAATCCTTCCGAGCAGACGCAATAGGAGCGCAGAACCAC
ATGCACAAACGACTCCCGCACTACATGGTCCCAACAGCTTTCCTCCCTTTGCATCGGCTTCCTCTATCAGGCACT
GGCAAAGCCGATCGCAAGCGCCTCCGACAATGTGCACTCTCTCTGTCCAGCCTTGAGCTCAATGCATATCGCGCC
ACAGCCTCCGCGAAGCGTATGCCTTTCACCGCAGCGGAGTGCAAAATGCAGGAATTGGTTGCAACTGTTCTGGGA
AGGGACATGTCCGAGATTGGCATGGATGACAGCTTTTTCTATCTGGGAGGTGACTCCATACAAGCAATGCGCCTG
GTTTCTGAGGGTCGTCAACAAGGCCTTACCCTCTCCCTTCAAGCAATCTTTGACGCTCCCCGTCTGGGTGACCTT
GCTTATCGGACAGCCAACCTGGTCAGAGTGAGCGAGCCAGCCCCGCCCACATTGCCAGCCACCTCAAGTGATGAT
TGCGACCATAAAGAGACAATAGTTGCAGCTCTGCCCATCAAGAAGACTGACGTGGCCGAAGTCCTTCCCACAACC
TCTTTTCAGCGCACCTGGCTAGACTCACAGCTGAAGAGCTACATTGTCGTCGACATCCCAGGCCCGATCGATCTT
GCACGTCTCCGTACGGCCATACAGCGGGTCGTGAAGGCGCACCCTATTCTCCGAGCGTCCTTCGTGCCTTATGAA
ACCACAACCATGCAAGTTATCCTCCGCACAGCAGTGGTCATCACAGAGGCCGACCTGTCCACCACTACCGTGGAA
GGCATTTGCCGCAAGGATGCAAATGCCCCAATGGCCCCTGGAACGCCGTATCTGCGCGTCATCCTAGCAACTCAA
GGAGAAGTAGATCGTAAACTGATCATGCGACTTTCTCACGCCCAATACGATGGTATCTCACTCTCCCTACTCATG
AATGATCTGAGTCACGCATACGCAAGCGAGTCTCGTCCATTACCTTCATCCCACTTGCCCGCGTTCAACGACTAT
ATTACCTATCAGCAAACTCAGGGAGCCGACCCCACAGCGACCACATTCTGGCATCGTCTCCTCAAAGACGTGCCA
ATTACCTACCTTGATCTCCAACCAGCCGAGACCCCAACCAGCAATGGATCCCTCATTACACGTACCCGCGACATT
AATATTGCTGCCTTCCCATCACTCCCTAACGGTATCACCACAGCCACAGCTGTCAAGGCAGCCTGGTCGCTGGTC
CTAGCCCAGAAGACTGGTTCCCTTGCCGTTATATTTGGCCAGGTTGTCCATGGTCGGGGAATTGCGCTTACCGGG
GTTGAGGGTATTGTCGGTCCTTGTGCTAATATTACGCCCGTCGTTGCACGCCTGGGTCCTCAAACTACAAGAATG
GAGTTAATGCAAACGTTGCAAGACCAACACCGCTCTGCTATGCCATATGAGACGGTAAGTCTGGATGACGCGCTG
GCTTATACTAAGGACTCGCAGGCCGGGCGTAAAGAGTTGCAAACAATCGTGCAGCATCAGAATAATGTGATGGCT
GACGATATGGAACTGTCGCTTGGAGAGGCAAGGTGTCGGGTCGATCTGAGGGCAGTGGATCATGTGCCACAAGAG
GTATGGGTATATTCGTCTATCGATGGGGGAAGACCGGGTATGTTGGAGGTGAAGATCATGTCGTCGACGTTGGTG
TTGAGTGAGGAGGTTGCGGAAGAGTTGATGGATTTGCTTGTAGAGATGATGAAGAGGTTGTTTAGCGATCCTGAG
GGTGTGTGTGTTTGA
Transcript >Ani_SJS100_1|g4670.t1
ATGAGTCGCTTTTCTTGCATCTTCCCTACCCTAACGGATGGGTATGTCCCAAATCTAGATCAAACTCGTGCCGCA
GGTCGGCGAACATACACGATCGACCGGAGAGGATGGACCGCCCCAAGCAGTCAGACAGAATCGCACATCCTAGCA
GCCTGGGGCCTTGTTCTATCCAGCTACGTAGGCACCGATGAAGTGGCTTTCTACATTGTGCCAACGACTGGTCCG
GACACAACAGCATTGGCTGAATTGAAGGTCGAGGGAGACATGTCTCGCCGGTCCCTCATCAACGCTGCCGAGCAG
TTGTTGCACCCAGGACCCGTGGGTGCCGGCCAGGTGTCTGGGGAGTCTGCCAATACGATAATCACCTTTGAGAAG
GATATTGAGTCGTTATTTGTTACTCAGGCCGAGGAGTCCTTCCTATCGTTACATGTTCATCATGATGGGCAAGGG
CAGGTCTCTCTTTCTCTTACCTACCACCTATCGCTCTTGACCGACGCGCAGGCAGCAAATGTGGGCACTGCGATG
GCCCAGGCGCTCGCCGAGGTGGGGGCAGACGACCACAATAGGTTAATCAAGAACCTCAATCTCATGAGCCCGACA
CACCTGGAAAGCATCTGGCAGTTTAATGCCAATGTTCCCGGTATGTGGGAGGAGTGCTTTCATGATGTGATTGAG
CGTCGCGCCGCGAATCGCCCACACTCCCTGGCGGTCGATGCCTGGGATATGAAGCTCACCTACGCCGACCTCGTA
AGGGAGGCACGTCTGCTCGCCGCATACCTGCAGCACCGCGGCGTGCGTCCAGGATCCGTGGTCCCCATTTCATTC
GAACGGTCGGGAGCAGCTCTGGTTGCCATGCTGGCTGTGTCCAAGGCCGGCGGAGCCTTTGTCAGTGTGCCACCG
ACTCTCCCTGCTGGACGACTCGACGCCATTCTGGAAGTCATCGAAGCACCGTTTGTGGTAACTTGGTCGAAGTAC
GAACCATTCTGGGCCGAACGCCTCCCTACGCTCCCTATAGACAGCTATCCCAAGCCATCTGCAGATGCGACGGTG
AAAACCCTCGGAAAGCCCGAGGACCTTTTCTATGTAATTTTCACTAGCGGTTCGACAGGCCGGCCGAAAGGCTGC
ATGCTGTCCCACTCGAACTGGCTGAACGGCGCGCTTCGTAACGCTCCTAGTTGGAAGTATGGTCCCGAGAGCCGT
GTCCTGCAAATGCTGAGCCACACCTTCGACATGAGTCTGCTGGAGATCTGCACCAGTCTGGGATCCGGGGCCTGC
GTGTGTGTGCCACGCACAGAGGAAATCGAAACCAGCGTCTCCGATGCCATCAACAGGTGGCAGGTTAATCATGTT
ATCATGACACCTTCACTTGCCCGCTCCTTGAGACGCGACGACGTGCCCGGGCTGAAGACAATGTGCCTTGGTGGT
GAAGCCTTCCCCAGGGAGATTGTCACCATGTGGTCCGAGCGGATTAATCTGTGGCAATTCTACGGCCCCAGCGAG
TGCTCAATTAACTCGTCATCGCGGCCAATCACACGGCCCGATGCGGATCCGTTGAATATCGGTCCTCCCAACTCG
GCTGCTTGCTGGGTAGTAGATACTCAAGATTACAATAAACTGGTTCCCGTTGGTGCTATTGGAGAGCTACTTGTT
TCTGGACCTATTGTCGGCATGGGATATCTCAAAAATCCCATTAAGACAGCCGAGGCTTTCCTTGATGAAGTCGGG
TTCGTGGCGAAGGATGATCCCCAGTTTGGTGGATTCCGGTTTTACCGAACAGGTGATCTCGTGCGGTGGAACTCG
GACGGTACTATCACTTTCTGCGGCCGTGCTGATACGCAAGTCAAGCTTAATGGCCAGCGACTTGAACTGGCCGAG
GTGGAATATCAGCTGGGGCTGGAAGCTGGCGTTCAGTATGCCATTGCAATGGCACCTCAATCTGGTCGGTGCAAG
AACAATCTGATTGCTGTTCTCACCGTCAAGTGCGGCGGCGCTAGCAACCAGGGTAATGCTGACGACGAAATCCCA
CTGCTGGACCGCCACGATCCGATTGTCCAGCAGACCGTTAAGAAGCTGCGTTCGCAACTTCAGCACGCTCTGCCG
CGGTATATGGTGCCCACCATCTGGGCGTTCGTTGGGCGCATGCCCATGTCACCGTCTGGCAAGATTGATCGCGTA
CAACTGAGGAACTGGGTGCAAGAGATGAGCCAGGAGACGTTCGACGCAATCACCGGTCGAAGTTTCGAGGCGGAA
GATCATGTTCTCGGCCTCAGCCAGCTAGAGCAGGAGATCCAGCTCGCCTGGGCCGAAGCTCTGGGTCTCTCCGCC
GCTGAGGTGGGCTTGCAGCAGCCATTTGTCGCGCTAGGCGGGGATTCCATCAAGGCCCTCGATGCCGTAGCTAGA
TGTCGGGCTCGTCAGATCAAGATTAGCATGGTGCATATCTTGTCTTGCGAAGGCGTCCGAGAGGCTTCCTCGCTG
GCAGAAGTGCAGGAGACCCCTGCTCATCAGGTGGCCGAGATCGCGGTGGATTACTCGGATCTGTGGACCCGTCTG
TCCACTGAATATGACATTAGCAAGCTGGGCGTCACGCAGGTTGAAGAGGTGGAGGATGTCTTCCCCTGCACAACC
ATGCAAGAGGGCATGTTCCTCGGCCAGATCCGTCGGCCTGGAGCCTACCACATGCGTTTTTTCCACCGCGTTCAG
CTGAAGGGTGGTTCCCTACCGACCGTTGAACGCATCCAGCAGGCCTGGGCCTCCCTTGTCGAGAGACATCCTTCA
TTACGCACAGTCTTCGTGGATGATCTGTCCTCAGAGGCCATTTATCATTCGGTCGTGCTGCGGTCCGTGCCGATG
GAGCTTACAATGCGTGAGGTGCCGCGAGACCTCAACCCCGAATCGGCCCTCGCTATGTTCACGGAGGAGCTCGTG
CCCTTTCGTCCTAATGCCCCATTACATCGCATGCTTCTGCTGACCTGCCGCGGACGCGTCCCATATCTTATGCTG
GAAATTTCTCACGTCATCATGGACGGCTATGCGCTGTCGGTTTTCCGACGCGAGTTCATCCGCGCCTGCTCCTCC
ACTGCCTCCCTGCCGCGAGGCCCAGACTACCGCATGTTTGCCAACTACCATCGCACACGACAAACCGACGAGAGT
GCAAAGTATTGGACAAATTACCTAGCCGACTGTGTGCCATGCCACATCCCTACGGATCCGTTGAGTGTGCCGACG
GATGCCTCCCCTGAATGGCCTCGGACGCTGCAGCGCCGCGACTTTGGCTTCGACAACAGCGTAGCGTTCCTGCAG
CGATGCAAAGAGCGCCAGGCTACACTCGCTTGTGCGATCCGCGCTGCCTGGGCGCTGGTGCTACGCGCCTACACC
CAATCACGGGATGTTTGCTTCGGCTACGTCTCCTCCGGGCGCAACGTGCCGGTGCCCGAGGTCGAGACTATTTTT
GGTTTGTGTCTCAGTATGCAGGTCTGTCGCGCAAAGCTAAGCGAGGCTTCCACAATCGCTAGCCTCGCTAGGAAG
ATCCAGGAGGATTATGTTGCTAGCTTGCCATTCCAGCACTACCCATTGGCAGAGGCACAACGCGGGCTGAAGCAA
ACACATGGACAGGGGCTGTTCAACACGGCGATCTCCATGGAATGGGTGCCTCCGACAGCGGAGGATGAGGATGCC
TTGCTGGATTTGGAGGAGATTCGTGAACAGGATGACCCGACTGAGTACGACATCGCCATCAGTGTGGATATCCAC
GAAGGCCACATCAAACTGGGCTTCCTCTATTGGCCCAACTTGAGCGACTTCCAGATTACCCATCTCGCCGAGGCC
CTCCAGGGTGCCATGAACTGCTTTGCCTTTCAGCCAGACGTGGCCCTGAACACTCTCACTCTTCTGCAGGCCAGT
GATTTGTGCTCCACCCTAACTAACGGACCTACCCTGCTGCCTCTAGAAGCCGTCCGCGGCAACGTGATATCGATG
ATAGACCGCTGGGTGACCCGCCAGCCGGAGAGCCCTGCCATCGACGGCTGGGATGGATCCCTGACCTACAAGCAA
CTGCACGAGCAATCCTCCTGGGTGGCTCGCAATCTGCTTCATCAAGGGGTAAAATTGGGAGACCGCATCCTGGTG
TGTGCAGACCGGTCAAGTCGCACTGTGGTAACAATTCTAGGCGTCGTGCGGGCAGGATGCGTGCTGGTGCTCTCG
AACCCGACGGACCCGGAAAAGCGCCTGCAGTGGCTGGCACACAAGTGCAATGCTACCCTGGTCGTTGCTGATCCT
GCATACGAAGAGCGGTTTGCGACTTCCGGTGCTCGTGTATTTTCAACAACCTCCGTTTGTGCCCCCGCAGCCTGG
GACTACGAGTTCTCAGCTCTGGACGATCAGGACCTTGTCAGCATCCTCTTTACCTCCGGCAGCACCGGCACCCCG
AAAGGCATATTGATGGACCATGGGGCACTCGCGACCAGTGTTCTCCTGGGCCATGGCCGCACGTTACGCTTCTCA
CGCCACACCCGCATGCTGCATTTTGCCTCCCTAACTTTTGACGCCGCTCTGGCGGAGATCTTTACCACCTTGGCA
CATGGTGGGTGTATCTGCGTGCCGTGTGAGGAAGACCGTCTCTCTGACGTGTCGGGTTGTATCTCCCGCTTTGCG
GTCAACACCGCTATGCTGACACCCTCCGTCGGGCGGCTGCTGGATCCCGAGGCTCTGCCAACGCTGAAGGCTCTG
GCCATGATCGGCGAACCGATGTCCCGGTTGGATGTTGAGCGGTTCGCCCCGGTACTTGACCTCTACAATGGTGCA
GGACCTACGGAAACATCCATAATGGTAACAATTGCCGGGCCGATGAAACCGACTGATGAGCCAGTGAATCTGGGT
TATGCCGTGGCCGGCGTTAGGCTGTGGGTGACTGAGGCTGAGAACCCTAATCGCCTGGCTCCGTTGGGAGCAGTC
GGAGAGTTGATCGTCGAGGGCCGCTTGGTCACTCGCGGATACCTGGATGATCCAGCACGCACTAGGGAGTCTTTC
CTTCCCAATTTACCATGGCTTCCGTCTCAGCATGCCTTGTACCGAACAGGCGATTTGGTGCGCTATGCGGAAGAT
GGCAGCTTGCGGTATATGGGACGGAAGGACACGCAGGTCAAGTTGCGTGGACAACGCATTGAGCTACAAGAGGTC
GAGTATCATCTGCGAAAGAGCTTACAGCAGGCACAGGTTGTGGTGGAGATGGTCATTCCAGAGGGGAAAATTCGT
GCTCAGGCAAGCTTAGTGGCTTTTGTCAGTGGTTTGACAGCGGCAGATGTTGAGTCGTCTTCGGCGCGTAACTTT
GACCAGTCGATGCCCATGTCACAAATCGCCTTGCCCGGCAGTACGATCCAAGCGCTTGAGGAAGCCCTGCCTCGC
TATATGATCCCGTCGGTGTATTTCGCCCTGGACACGATCCCGCTCTCAGTCAACGGCAAGGCAGATCGGCGAAGA
CTGCGTGAGATAGGTGCCGCGCTGCTGGTATCCAGTACCGCCCATAAGAACACTGTTGATGGAAAGAGCGAGCCT
GTCAAATGGACAGCATCTTCGAAATTGGAGCTGACACTGTTGGAATTGTGGACTACGACACTTGGACTTGAGGCT
GAAACAATCTATGGCGATGATAGCTTCTTTGAATTAGGCGGCGACTCTGTTTCTGCCATGAAGCTGGTGGCCACG
GCTCGGGATAGATTCAAGCTGTCGTTGAGTGTTCCTCAAATGTTCAGACACCCCACTATTCATCAGCTTGCCGCC
ATACTTGGGGAGGCCACTGGGCAGCCAGAAAGCTCAGCTTCGTCCACGACTGAGGAAGGATTCACATTCAGCACG
CCAGATGACTCCTCCACCAATGACGGGGTCGATGACGATTTTCTACGGCTGGCCACCGCTCAGCTTGCCCAACTG
GCGCAAGAGAAGGGTAAGAAGGTGGATATTGCTGCTCTTCTAAAGCAGCTGCAAGGCGGTTCCTCTTCCTGTAAG
ACCCCATCCGTGTCTTCCTCCTCATCATCGTCGTCGTCGAGGAAGAAGAAGTCAGCCAAAGTGGTGTCCCCAGTC
GAAGCACCTGCTCCTGTCCCAGTGCCATTTTCCTTGTTGGATGGCGGCGCTGATGTTGTAGAGAAGATTCGTGCA
CAGGCCGTGGAGCAGTGCAAGATCCTACCCGGGGATATTGAAGATATTTATCCCGCCACCGCTCTACAGGAGGGG
ATGATGGCGCTGATGGCCAGGACACCCGGGGTTTATACAACAACTTTAACATGTGAGCTCCCTGAGCGGGTTAAT
CTTGCACGGCTGCACTCCGCATGGGATAAAGCTGCCGAGGCGCATCCAATTTTGCGGACGCGGATTATCCTCACC
GAAAACAACACGGCAGTGCAGGTTGTGCAGCGTGCGAAAGAGCTTCCATGGGATGCCTATTCCCTTCAGGATGGC
GACCCTCTGCCAGACCTAACGTCGAACATGACCCTTGGTTCTACCCTTCTGCGCCTAGCTGAGATACACCGGCAA
AACCAGCCTCGGATGCTGCTGGTGGCCATTCATCACGCTCTCTACGACGGATGGTCAATGCCACTGCTCAAACAG
GCAGTTGAGGATGTCTATCATGGACAGGAGTTGTGGCCACAGCCCTTCACCCCATTCATTAATTACCTAAATGAG
GGAAAGCCGGCGGCACAAGGCTACTGGACCGCCCACCTGGACGGCTTCGCAGGAAGCGTCTTCCCTAATTTGCCT
AGCATAAACCACCATATCCAGCCGACGGAGCGTCGAACCCGCTCACTGGCCGTGCCGACAGCGCCCCCCGGATCG
CAGTATACTATGGCGACAAAAATCCAAGCAGCGTGGGCTGTCACGGTTTCGCGATATGCAGAGGCTGAGGACATT
GTCTTTGGTACCGTTAGTACCGGTCGTTCGGCACCTGTGCCGTCGATTGATCGCATGGTCGGTCCCACCATCACG
ACTGTGCCTGTTCGCATCTCGCTCGGCAACCAGGCAGAGCGTCTCACCTCACTGCTGCAGAGGGTCCAAGAGGAT
GGCTGGAACAGGATGGATCATGAACACCTGGGCCTCCAGCACATCCGCCGTCTCGGTGAATCTGCTGCTGCTGCT
TGTAACCTCCAGACGCTGTTAGTAATTCAGCCTCGTGAAGAGCCTCGTGCCAAATCCATTTCCACCTTACTTTCA
GGATTGCAAGACGTGGCTGAACTCAAGGGCGTGGATACGTATCCGCTAATGTTGGTGTGCGAGCCTGATGGTGTC
AGTCTGCATTTGACTGCCGTGTTTGATCCAGCCGTCCTGGACGCAGTCATGCTGGACCGGATGCTTGCTCATTGG
GAGCTCGTTCTAAATCAAATATGGAGTGAGCCGGACATGGCAGTGATGGGGCTTGATGGCGTATCATACAGGGAT
AAGCAGACATTGGTAAGATGGAATGCTGGAGAAAAGATTGCTGATGGATGTGCCCATGACGCGGTGTATGAGTGG
AGTGTCCGCACCCCTCATGCACCCGCTGTCTTCGCTTGGGATGGTAAATGGACCTACGAGGAACTGGAGAAGTGC
TCCTCTCTCATAGCCAGTCAGGTCCTAGTCCATGGTGTCTCCTCCGGAGACTTTGTTGCTCTTTACCACGAGAAG
TCTCGATGGGCGGCGGCCGCAATTCTCGCGGTGTTCAAAGCCGGCGGCATCCTGGTTACCTTGGACCCGGCCCAT
CCCAAAGACAGAATCAAGGATATCCTGGATCAAGCACGGCCGCGACTCGTACTGACCTCTCAGTCTCTCCTCGAT
GAGGCTAGAGAACTTGAGACCCCGGTCATGGTTGTACAGTTCGCAGCATCCCAACCAATGCCCGGAGAATGCTTC
CCTCTACCCACAGTAAGCCCCACCCAGGCTGCATATGCTCCGTTTACCTCTGGATCTACAGGTCGACCAAAAGGG
ATTCCATTAGAGCATCGGGGACTGGCTGCTTCAACTGCTTCAGTAGCTCGTGCCTGCCTACTGCGCCCAGCATCC
CGAGTCCTTCATTTTGCCAGCTTCGCCTTTGATGCCAGTATGATGGAGCACCTGATAGCCTGGCACGCCGGCAGC
TGTCTCTGTATCCCGGTTGAAACTGTCAGGCAGACGGATCTGGCCAGGTGCATACGAGACTTCGAAGTTACTTGG
GCTTTTCTCACACCTTCATGCCTACGGCTAATCTCCCCCGATGATGTTCAGTCCCTTGAAGCCCTGGGTCTAGGT
GGTGAGTCTATGACGCCCGAGGATATTTTCATCTGGGGTCCGCGACTCCGCCAGATTGTCCAGCTATACGGCCCG
GCGGAGTGTTCCATTGTGGCCGCGTTGACAGAAGTTACCAAGCCATCGGAGAACCGATTGATAGGGAGACCCAAT
GCCTGTCGATGCTGGGTAGTTGACCCACACAGCCCAGATCGCCTAGCGCCCCTAGGTGCTGTCGGAGAGCTGGTA
ATTGAGGGGATCACTGTCGGTCGGGGTTATATTGACGATCCCGAGCGAACCACCCAAGCATTTATACCACCCCCT
ACATGGATTCAAACACTGTATCCGAATGAGCAACAGCCAAGTCGCCTCTATCGGACCGGTGATCTCGTACGGTAT
GCTGGTACGGACGGGAAGCTGACCTTCATCGGGCGAAGGGACGGCCAACTCAAGCTTCACGGACAACGTATAGAG
TTGGCGGACGTCGAAGCTCACCTCCGTCCTCTAATACCCGGCACGCAGAAGGTTGTTGTAGAGATGGTTCACAGT
GTGGGCAACCACCACCCCCTTTTAGCTGCCTTTGTGGAAGAAATATTGACATCACAAGATCAAGTGGAGCAAGTG
GTTAATCTATTGCACCCAAGTCAAACCCAATGTGCCCTGAATGTCAAGGCCATCGATAGTGCACTGTCCCAAACG
GTTCCCCAATACATGATTCCTAGCATGTATCTACATATCTCCCGCCTGCCCCTAAGCGCATCTGGAAAGCTCAAC
CGTCGCCACCTGCGTAGGTTGGTCGCAGAGTTTCCACGTCAGAGACTCAGTGAATACGCTGCTGGATCAGGCCTC
GCAGTCCCGAACCGGCCGGCAACAGCTCAGGAGCGTGAAATGCAGGCTATCTGGGCGCGAGTATTGTCAGTTGAC
CCGGACACAATCGGAGTCAACGAAGACTTTTTCCGCATCGGCGGCGACTCCATTTCCGGGATGCAGGTTGCCACG
AGATGCAATGCGGCAGGCATGCATATCACCAGTGCGGATCTCTTCCAACACCGTACCATCGAGCAACTGATGCGC
CATCTTAGTGCTAATGGAAAGACTGGCTCCGCGTCAATCTCACTACCTCCAGAGCCGGTGGACGAGTGGGTTCCT
CTTGCCCCCATCCAGCAACTCTTCTTCGAAATCGCCCCACAGGGTCCAGATCACTTCAACCAGAGCCTGCTCCTG
CGCACTAGCCGCCGGGTCAGTGCAGAAAAACTCGCCGGAGGCCTAGATATTCTCGTGGGACGACATTCTATGCTA
CGCGCGAGATTTTGTCGCGATGATTCCGGCCAATGGTCCCAGCAGGTAAGGTCGCGCGGCCCGTACCCTGCTAGT
GCATTTTACCGGTTGACCACACACAACCACATCGCTCCTGAGTTGCTGTCGTCACTTCTTGCTGCGTCTCAGATG
GCCTTGTCTATTCAAGAGGGGCCGCTCTTAGCCGTTGATCTGGTGAATTTGACGGACGATACTCAGCTCGTCTAC
TTGGTGGCCCATCATCTCATTATCGACCTGGTCTCGTGGCGCATCTTGCACGCGGAATTGGAGGAATATCTGCAG
ACGGGCTCCTTCGCGTCCACCACAGGCTCTGTCCCCTTCTTGACCTGGAGTCGAGCACAGGCCGAATACAGCGCT
AATCACCTTACTCCCACACTTCCTCTACCTGGCTTCCAGGAAGCAAACGATGGCTTCGATGCCTCGAGGTACTGG
GGGATTTCTTGCGAGTCGAACACATTCGGGCAAACCTCCACTTCCACGTTCACCTTGGACCAGACTGTGACCGAC
CAACTCTTCGGCCCCGCTAACAACGTGCTTGATACTCGACCAGCTGAAATTTTGCAAGCTGCCCTCTGGTACTCT
TTCACTCAATCTCTCACCGACCGTCCGGGTCCCAGCATCTACGTTGAAGGTCACGGGCGAGAACCGTGGACGGGT
TCCATTGACCTTTCGGGAACGGTCGGTTGGTTTACAACCATGTCTCCGCTAGTGTCCGCTCCGTGGGATAGCCTA
TCACAGACATCGATGCGGGACTTCCTCGATGCGCTCAGCTATATCAAGGACCAGCGCCGACGCATTCCGGCTAAC
GGATGGGCGTACTTCACCTCACGATATTTGAACGACGAAGGCAAGGTCGCGTATGGGCGCATGAAGCCGGTCGTG
GAAATTCTGTTTAACTATATGGGCCAGTACCAGGAGATGAACCGTGAGGACGCCATACTACAGCTGGCTGGCGAT
GGCATCCAGTCCGGTACCGGTGCTGCAGACGTTGCGGACAACGTACCACGCTTTTCGTTGATCGACGTTAGCGCG
TTCATCTCGAACGGATGTCTAACCTTCCAGTTTATACTCCCTAAATCTTTGCAGCAGGACTCTCGACTGCAAGGG
TGTTTTCAGGAATATGAACGCACTCTCGTCGCCGCTGCTAATTCACTGTCAACTGAGGGCCCCCGCAAAACATTG
GCCGACTTTCCCCTTATGCCTGCACTCACATACGATCAGCTAAGCCAGTGCCTTGATCATACGCTGCCTTCGATG
GACCGACTCACATTAGAAAAGCTGAAGGACGCTTGGACTGAAGTGATCAACCGGCATGACATCCTCCGTACTCTC
CTTCTACCAGTTTCGGATTACAGCCACTTGGACCAAGTAGTCATGGCCCCTGGCAGTCTTCAACATCTGGTTCGG
ATTAATGCGATGGACACCAATCCCACACAGGGCCTACCACACTCGATTAACATCACCAGCGACTCAACCGGCACT
GTAATTTGCGAGTGGAATGTCAGTCACGCCTTGGTCGATGCCATGTCGATTGCGGTCATTCAACAGGAGGTCAAT
GAGGCGCTGGAAGGGTCGCTGGGTCAGCATCAAAAAACACCGCGATACGCAGATTACATCCAATGGCTTTCTCTG
CAAGACAACACCGAGACACAGGCGTATTGGAAAAAGTACCTCGAGGGAGTGGAGCCATGTCTCTTTCCAAAATTG
GCTTCTTCGACTGACAAAGTCAACCCGGAAGGTACCATTTCTGCCATTCGTGCCACCTGGACCCGCGATTCGCGG
TTGGACAAGCTATGCCATACGCACGGTATCACATTGACAAACCTATTCCACATTGTCTGGTCCCTTCTTCTCAGC
GCCTATCTAGGCACTGATAAGGTTTGCTTCGGCTATACGACCCTTGGTCGAGATGTGCCTGTCGACGGGGTAGAG
AAGATGGTCGGCCCTCTAGTCAATGTTATTGCCACAACCATCCAACTTCAAGAGGACGATTCGATCTTGGATGCA
CTTCTCACTCATCAAACCCATCTCTCAAATAGTCTCCAACACCAGCATTATGCGTTGGCAGACGTGTATGCCTCT
TTAGGTCTGGTCGGTTCTCAGCTGTTCAACACTATCGTGTCTTTGCAGGATATATCTCACTTCGATGCCAACGAC
GAGCGGCCGACCAGGGTCGAAATGCTCCCTGCAAATGACGTCTCAGAGTATGATGTGGCTCTCAATATCGGTGTC
GATCAATCTTCCATTCAAGTGGTCTGCAGCTACCGAACACTATCGCTGTCTGTGGAGCAGGCCGACGCGCTACTG
CGAACTACCTCCCATGTACTGGATGAAATCCTGAGGGATCCCAAGCAACCGCTTCGGGACCTTGAGGTGATTAGC
CCCCAGTGTAAAGAGCAACTCGTAAAGTGGAACGCTGCCATGCCTGCCCCGACCGATGAATACATCCATGAGAAG
ATTCAGGACCAATGCCGTCTCCACTCTTCCCGAGAAGCCGCTTGCGCCTGGGACGGCATATTTACGTTCGCTGAA
GTTGACGACCTATCGTCACGTCTGGCAGCACGGCTTATTAGGATGGGGGTTACCTCCGGTCACATCATACCAATC
TACTCACCCAAATCCCGATGGACGGTCATCGCCATTCTAGGAGTCCTAAAAACTGGGGCTGCCTTCACACTTCTA
GAAACATCGCATCCGACGGCTCGACTGCGCGTTATATGCAATGAGATCAAGGCTGATATAATAATCGCGCCAGCA
TCGCATGCCGTCCCAGCGGCAACTTTGGCTCCTATCCTAGTCGTGCTCGACAGCATCACGTCGATGAGCCCCCAA
GAATCAGATCTCTTACCAGCTGTGGGTATGCCACCGGCTGCAGAAGCTCTCGCCTATCTCATCTTCACTTCAGGC
TCCACAGGAAACCCCAAGGGGGTTATGGTCACTCATCAGAATTTGTGCAGTAATGCGTCTATAATGACAACATCT
GTCAATATGACATCCGACAGCAGGGTGCTACATTTTGCATCCCATGCATTCGATGCGTGTCTTTGGGAAATATTT
GGTGCCCTATTTGCCGGTGCTTGTCTGATCATCCCGTCCGAGTCAGAGACCAAGGAAGATCTGGCTGGTTGTATC
GAGCGCATGGTCGTCACTTGGGCATTTCTGACCCCTTCCGTCGCAAGGATCTTAAAGCCAGAGGCCCTTCCCAGT
CTCCGTAATTTAGTCCTGGGAGGCGAGCCGATAGCGGCCTCGGATTTAGATATGTGGCGGGGTCACGTACAGGTT
GTGTGTGCCTATGGACCAACCGAAACCGCCATCCTCGCCAGTACGACCTCACCCTCTACCTTTCCCAGCGATGGC
AAGGATATCGGCGTGCCAACTGGTAGCTCCCTTTGGATTGTTGACAAGCAAAATTACAACAAGCTGGCACCTCAT
GGAGCCACAGGCGAGCTGCTGATTGAGGGCCCCAATGTGAGCCAAGGATATCTTGGGGATCCAGAGAAAACCAAT
GAAGCCTTCCCAGTCGCTCCACGCTGGCTGTCACAGCTCCGAAAGTCGCCTACCAGGGTCTACCGAACTGGTGAC
TTGGTTCGCTTCAACACATCTACGGGCACCATTCACTTCGTTGGACGCAAGGATAACCAGATCAAGTTCCACGGA
CAGCGCATCGAGCTCGGTGACATCGAACATCATGCTCAGCAGGCCTTTTCGAATGCCAGCATGGTCATCGTCGAT
TTGATTACCCCTGAACAGCCTCAACAACCATATATTGTTGCTTTCGTACATCAAGCAGATACAAGGACTGGAACG
GCCGACCCAATTGACACCATCTTGCTTCCTCCCTCCGAATCCTTCCGAGCAGACGCAATAGGAGCGCAGAACCAC
ATGCACAAACGACTCCCGCACTACATGGTCCCAACAGCTTTCCTCCCTTTGCATCGGCTTCCTCTATCAGGCACT
GGCAAAGCCGATCGCAAGCGCCTCCGACAATGTGCACTCTCTCTGTCCAGCCTTGAGCTCAATGCATATCGCGCC
ACAGCCTCCGCGAAGCGTATGCCTTTCACCGCAGCGGAGTGCAAAATGCAGGAATTGGTTGCAACTGTTCTGGGA
AGGGACATGTCCGAGATTGGCATGGATGACAGCTTTTTCTATCTGGGAGGTGACTCCATACAAGCAATGCGCCTG
GTTTCTGAGGGTCGTCAACAAGGCCTTACCCTCTCCCTTCAAGCAATCTTTGACGCTCCCCGTCTGGGTGACCTT
GCTTATCGGACAGCCAACCTGGTCAGAGTGAGCGAGCCAGCCCCGCCCACATTGCCAGCCACCTCAAGTGATGAT
TGCGACCATAAAGAGACAATAGTTGCAGCTCTGCCCATCAAGAAGACTGACGTGGCCGAAGTCCTTCCCACAACC
TCTTTTCAGCGCACCTGGCTAGACTCACAGCTGAAGAGCTACATTGTCGTCGACATCCCAGGCCCGATCGATCTT
GCACGTCTCCGTACGGCCATACAGCGGGTCGTGAAGGCGCACCCTATTCTCCGAGCGTCCTTCGTGCCTTATGAA
ACCACAACCATGCAAGTTATCCTCCGCACAGCAGTGGTCATCACAGAGGCCGACCTGTCCACCACTACCGTGGAA
GGCATTTGCCGCAAGGATGCAAATGCCCCAATGGCCCCTGGAACGCCGTATCTGCGCGTCATCCTAGCAACTCAA
GGAGAAGTAGATCGTAAACTGATCATGCGACTTTCTCACGCCCAATACGATGGTATCTCACTCTCCCTACTCATG
AATGATCTGAGTCACGCATACGCAAGCGAGTCTCGTCCATTACCTTCATCCCACTTGCCCGCGTTCAACGACTAT
ATTACCTATCAGCAAACTCAGGGAGCCGACCCCACAGCGACCACATTCTGGCATCGTCTCCTCAAAGACGTGCCA
ATTACCTACCTTGATCTCCAACCAGCCGAGACCCCAACCAGCAATGGATCCCTCATTACACGTACCCGCGACATT
AATATTGCTGCCTTCCCATCACTCCCTAACGGTATCACCACAGCCACAGCTGTCAAGGCAGCCTGGTCGCTGGTC
CTAGCCCAGAAGACTGGTTCCCTTGCCGTTATATTTGGCCAGGTTGTCCATGGTCGGGGAATTGCGCTTACCGGG
GTTGAGGGTATTGTCGGTCCTTGTGCTAATATTACGCCCGTCGTTGCACGCCTGGGTCCTCAAACTACAAGAATG
GAGTTAATGCAAACGTTGCAAGACCAACACCGCTCTGCTATGCCATATGAGACGGTAAGTCTGGATGACGCGCTG
GCTTATACTAAGGACTCGCAGGCCGGGCGTAAAGAGTTGCAAACAATCGTGCAGCATCAGAATAATGTGATGGCT
GACGATATGGAACTGTCGCTTGGAGAGGCAAGGTGTCGGGTCGATCTGAGGGCAGTGGATCATGTGCCACAAGAG
GTATGGGTATATTCGTCTATCGATGGGGGAAGACCGGGTATGTTGGAGGTGAAGATCATGTCGTCGACGTTGGTG
TTGAGTGAGGAGGTTGCGGAAGAGTTGATGGATTTGCTTGTAGAGATGATGAAGAGGTTGTTTAGCGATCCTGAG
GGTGTGTGTGTTTGA
Gene >Ani_SJS100_1|g4670.t1
ATGAGTCGCTTTTCTTGCATCTTCCCTACCCTAACGGATGGGTATGTCCCAAATCTAGATCAAACTCGTGCCGCA
GGTCGGCGAACATACACGATCGACCGGAGAGGATGGACCGCCCCAAGCAGTCAGACAGAATCGCACATCCTAGCA
GCCTGGGGCCTTGTTCTATCCAGCTACGTAGGCACCGATGAAGTGGCTTTCTACATTGTGCCAACGACTGGTCCG
GACACAACAGCATTGGCTGAATTGAAGGTCGAGGGAGACATGTCTCGCCGGTCCCTCATCAACGCTGCCGAGCAG
TTGTTGCACCCAGGACCCGTGGGTGCCGGCCAGGTGTCTGGGGAGTCTGCCAATACGATAATCACCTTTGAGAAG
GATATTGAGTCGTTATTTGTTACTCAGGCCGAGGTACGCGCGTCGCCACCCCGTATTACAGTGGCCTACCTGGGC
TTGTGGAAACTAACGGGCATCTAGGAGTCCTTCCTATCGTTACATGTTCATCATGATGGGCAAGGGCAGGTCTCT
CTTTCTCTTACCTACCACCTATCGCTCTTGACCGACGCGCAGGCAGCAAATGTGGGCACTGCGATGGCCCAGGCG
CTCGCCGAGGTGGGGGCAGACGACCACAATAGGTTAATCAAGAACCTCAATCTCATGAGCCCGACACACCTGGAA
AGCATCTGGCAGTTTAATGCCAATGTTCCCGGTATGTGGGAGGAGTGCTTTCATGATGTGATTGAGCGTCGCGCC
GCGAATCGCCCACACTCCCTGGCGGTCGATGCCTGGGATATGAAGCTCACCTACGCCGACCTCGTAAGGGAGGCA
CGTCTGCTCGCCGCATACCTGCAGCACCGCGGCGTGCGTCCAGGATCCGTGGTCCCCATTTCATTCGAACGGTCG
GGAGCAGCTCTGGTTGCCATGCTGGCTGTGTCCAAGGCCGGCGGAGCCTTTGTCAGTGTGCCACCGACTCTCCCT
GCTGGACGACTCGACGCCATTCTGGAAGTCATCGAAGCACCGTTTGTGGTAACTTGGTCGAAGTACGAACCATTC
TGGGCCGAACGCCTCCCTACGCTCCCTATAGACAGCTATCCCAAGCCATCTGCAGATGCGACGGTGAAAACCCTC
GGAAAGCCCGAGGACCTTTTCTATGTAATTTTCACTAGCGGTTCGACAGGCCGGCCGAAAGGCTGCATGCTGTCC
CACTCGAACTGGCTGAACGGCGCGCTTCGTAACGCTCCTAGTTGGAAGTATGGTCCCGAGAGCCGTGTCCTGCAA
ATGCTGAGCCACACCTTCGACATGAGTCTGCTGGAGATCTGCACCAGTCTGGGATCCGGGGCCTGCGTGTGTGTG
CCACGCACAGAGGAAATCGAAACCAGCGTCTCCGATGCCATCAACAGGTGGCAGGTTAATCATGTTATCATGACA
CCTTCACTTGCCCGCTCCTTGAGACGCGACGACGTGCCCGGGCTGAAGACAATGTGCCTTGGTGGTGAAGCCTTC
CCCAGGGAGATTGTCACCATGTGGTCCGAGCGGATTAATCTGTGGCAATTCTACGGCCCCAGCGAGTGCTCAATT
AACTCGTCATCGCGGCCAATCACACGGCCCGATGCGGATCCGTTGAATATCGGTCCTCCCAACTCGGCTGCTTGC
TGGGTAGTAGATACTCAAGATTACAATAAACTGGTTCCCGTTGGTGCTATTGGAGAGCTACTTGTTTCTGGACCT
ATTGTCGGCATGGGATATCTCAAAAATCCCATTAAGACAGCCGAGGCTTTCCTTGATGAAGTCGGGTTCGTGGCG
AAGGATGATCCCCAGTTTGGTGGATTCCGGTTTTACCGAACAGGTGATCTCGTGCGGTGGAACTCGGACGGTACT
ATCACTTTCTGCGGCCGTGCTGATACGCAAGTCAAGCTTAATGGCCAGCGACTTGAACTGGCCGAGGTGGAATAT
CAGCTGGGGCTGGAAGCTGGCGTTCAGTATGCCATTGCAATGGCACCTCAATCTGGTCGGTGCAAGAACAATCTG
ATTGCTGTTCTCACCGTCAAGTGCGGCGGCGCTAGCAACCAGGGTAATGCTGACGACGAAATCCCACTGCTGGAC
CGCCACGATCCGATTGTCCAGCAGACCGTTAAGAAGCTGCGTTCGCAACTTCAGCACGCTCTGCCGCGGTATATG
GTGCCCACCATCTGGGCGTTCGTTGGGCGCATGCCCATGTCACCGTCTGGCAAGATTGATCGCGTACAACTGAGG
AACTGGGTGCAAGAGATGAGCCAGGAGACGTTCGACGCAATCACCGGTCGAAGTTTCGAGGCGGAAGATCATGTT
CTCGGCCTCAGCCAGCTAGAGCAGGAGATCCAGCTCGCCTGGGCCGAAGCTCTGGGTCTCTCCGCCGCTGAGGTG
GGCTTGCAGCAGCCATTTGTCGCGCTAGGCGGGGATTCCATCAAGGCCCTCGATGCCGTAGCTAGATGTCGGGCT
CGTCAGATCAAGATTAGCATGGTGCATATCTTGTCTTGCGAAGGCGTCCGAGAGGCTTCCTCGCTGGCAGAAGTG
CAGGAGACCCCTGCTCATCAGGTGGCCGAGATCGCGGTGGATTACTCGGATCTGTGGACCCGTCTGTCCACTGAA
TATGACATTAGCAAGCTGGGCGTCACGCAGGTTGAAGAGGTGGAGGATGTCTTCCCCTGCACAACCATGCAAGAG
GGCATGTTCCTCGGCCAGATCCGTCGGCCTGGAGCCTACCACATGCGTTTTTTCCACCGCGTTCAGCTGAAGGGT
GGTTCCCTACCGACCGTTGAACGCATCCAGCAGGCCTGGGCCTCCCTTGTCGAGAGACATCCTTCATTACGCACA
GTCTTCGTGGATGATCTGTCCTCAGAGGCCATTTATCATTCGGTCGTGCTGCGGTCCGTGCCGATGGAGCTTACA
ATGCGTGAGGTGCCGCGAGACCTCAACCCCGAATCGGCCCTCGCTATGTTCACGGAGGAGCTCGTGCCCTTTCGT
CCTAATGCCCCATTACATCGCATGCTTCTGCTGACCTGCCGCGGACGCGTCCCATATCTTATGCTGGAAATTTCT
CACGTCATCATGGACGGCTATGCGCTGTCGGTTTTCCGACGCGAGTTCATCCGCGCCTGCTCCTCCACTGCCTCC
CTGCCGCGAGGCCCAGACTACCGCATGTTTGCCAACTACCATCGCACACGACAAACCGACGAGAGTGCAAAGTAT
TGGACAAATTACCTAGCCGACTGTGTGCCATGCCACATCCCTACGGATCCGTTGAGTGTGCCGACGGATGCCTCC
CCTGAATGGCCTCGGACGCTGCAGCGCCGCGACTTTGGCTTCGACAACAGCGTAGCGTTCCTGCAGCGATGCAAA
GAGCGCCAGGCTACACTCGCTTGTGCGATCCGCGCTGCCTGGGCGCTGGTGCTACGCGCCTACACCCAATCACGG
GATGTTTGCTTCGGCTACGTCTCCTCCGGGCGCAACGTGCCGGTGCCCGAGGTCGAGACTATTTTTGGTTTGTGT
CTCAGTATGCAGGTCTGTCGCGCAAAGCTAAGCGAGGCTTCCACAATCGCTAGCCTCGCTAGGAAGATCCAGGAG
GATTATGTTGCTAGCTTGCCATTCCAGCACTACCCATTGGCAGAGGCACAACGCGGGCTGAAGCAAACACATGGA
CAGGGGCTGTTCAACACGGCGATCTCCATGGAATGGGTGCCTCCGACAGCGGAGGATGAGGATGCCTTGCTGGAT
TTGGAGGAGATTCGTGAACAGGATGACCCGACTGAGGTGAGTTCAAAATCCAACCGTCAAGACTTACCTTACTGA
TGGCGTGTGACGCTGCATAGTACGACATCGCCATCAGTGTGGATATCCACGAAGGCCACATCAAACTGGGCTTCC
TCTATTGGCCCAACTTGAGCGACTTCCAGATTACCCATCTCGCCGAGGCCCTCCAGGGTGCCATGAACTGCTTTG
CCTTTCAGCCAGACGTGGCCCTGAACACTCTCACTCTTCTGCAGGCCAGTGATTTGTGCTCCACCCTAACTAACG
GACCTACCCTGCTGCCTCTAGAAGCCGTCCGCGGCAACGTGATATCGATGATAGACCGCTGGGTGACCCGCCAGC
CGGAGAGCCCTGCCATCGACGGCTGGGATGGATCCCTGACCTACAAGCAACTGCACGAGCAATCCTCCTGGGTGG
CTCGCAATCTGCTTCATCAAGGGGTAAAATTGGGAGACCGCATCCTGGTGTGTGCAGACCGGTCAAGTCGCACTG
TGGTAACAATTCTAGGCGTCGTGCGGGCAGGATGCGTGCTGGTGCTCTCGAACCCGACGGACCCGGAAAAGCGCC
TGCAGTGGCTGGCACACAAGTGCAATGCTACCCTGGTCGTTGCTGATCCTGCATACGAAGAGCGGTTTGCGACTT
CCGGTGCTCGTGTATTTTCAACAACCTCCGTTTGTGCCCCCGCAGCCTGGGACTACGAGTTCTCAGCTCTGGACG
ATCAGGACCTTGTCAGCATCCTCTTTACCTCCGGCAGCACCGGCACCCCGAAAGGCATATTGATGGACCATGGGG
CACTCGCGACCAGTGTTCTCCTGGGCCATGGCCGCACGTTACGCTTCTCACGCCACACCCGCATGCTGCATTTTG
CCTCCCTAACTTTTGACGCCGCTCTGGCGGAGATCTTTACCACCTTGGCACATGGTGGGTGTATCTGCGTGCCGT
GTGAGGAAGACCGTCTCTCTGACGTGTCGGGTTGTATCTCCCGCTTTGCGGTCAACACCGCTATGCTGACACCCT
CCGTCGGGCGGCTGCTGGATCCCGAGGCTCTGCCAACGCTGAAGGCTCTGGCCATGATCGGCGAACCGATGTCCC
GGTTGGATGTTGAGCGGTTCGCCCCGGTACTTGACCTCTACAATGGTGCAGGACCTACGGAAACATCCATAATGG
TAACAATTGCCGGGCCGATGAAACCGACTGATGAGCCAGTGAATCTGGGTTATGCCGTGGCCGGCGTTAGGCTGT
GGGTGACTGAGGCTGAGAACCCTAATCGCCTGGCTCCGTTGGGAGCAGTCGGAGAGTTGATCGTCGAGGGCCGCT
TGGTCACTCGCGGATACCTGGATGATCCAGCACGCACTAGGGAGTCTTTCCTTCCCAATTTACCATGGCTTCCGT
CTCAGCATGCCTTGTACCGAACAGGCGATTTGGTGCGCTATGCGGAAGATGGCAGCTTGCGGTATATGGGACGGA
AGGACACGCAGGTCAAGTTGCGTGGACAACGCATTGAGCTACAAGAGGTCGAGTATCATCTGCGAAAGAGCTTAC
AGCAGGCACAGGTTGTGGTGGAGATGGTCATTCCAGAGGGGAAAATTCGTGCTCAGGCAAGCTTAGTGGCTTTTG
TCAGTGGTTTGACAGCGGCAGATGTTGAGTCGTCTTCGGCGCGTAACTTTGACCAGTCGATGCCCATGTCACAAA
TCGCCTTGCCCGGCAGTACGATCCAAGCGCTTGAGGAAGCCCTGCCTCGCTATATGATCCCGTCGGTGTATTTCG
CCCTGGACACGATCCCGCTCTCAGTCAACGGCAAGGCAGATCGGCGAAGACTGCGTGAGATAGGTGCCGCGCTGC
TGGTATCCAGTACCGCCCATAAGAACACTGTTGATGGAAAGAGCGAGCCTGTCAAATGGACAGCATCTTCGAAAT
TGGAGCTGACACTGTTGGAATTGTGGACTACGACACTTGGACTTGAGGCTGAAACAATCTATGGCGATGATAGCT
TCTTTGAATTAGGCGGCGACTCTGTTTCTGCCATGAAGCTGGTGGCCACGGCTCGGGATAGATTCAAGCTGTCGT
TGAGTGTTCCTCAAATGTTCAGACACCCCACTATTCATCAGCTTGCCGCCATACTTGGGGAGGCCACTGGGCAGC
CAGAAAGCTCAGCTTCGTCCACGACTGAGGAAGGATTCACATTCAGCACGCCAGATGACTCCTCCACCAATGACG
GGGTCGATGACGATTTTCTACGGCTGGCCACCGCTCAGCTTGCCCAACTGGCGCAAGAGAAGGGTAAGAAGGTGG
ATATTGCTGCTCTTCTAAAGCAGCTGCAAGGCGGTTCCTCTTCCTGTAAGACCCCATCCGTGTCTTCCTCCTCAT
CATCGTCGTCGTCGAGGAAGAAGAAGTCAGCCAAAGTGGTGTCCCCAGTCGAAGCACCTGCTCCTGTCCCAGTGC
CATTTTCCTTGTTGGATGGCGGCGCTGATGTTGTAGAGAAGATTCGTGCACAGGCCGTGGAGCAGTGCAAGATCC
TACCCGGGGATATTGAAGATATTTATCCCGCCACCGCTCTACAGGAGGGGATGATGGCGCTGATGGCCAGGACAC
CCGGGGTTTATACAACAACTTTAACATGTGAGCTCCCTGAGCGGGTTAATCTTGCACGGCTGCACTCCGCATGGG
ATAAAGCTGCCGAGGCGCATCCAATTTTGCGGACGCGGATTATCCTCACCGAAAACAACACGGCAGTGCAGGTTG
TGCAGCGTGCGAAAGAGCTTCCATGGGATGCCTATTCCCTTCAGGATGGCGACCCTCTGCCAGACCTAACGTCGA
ACATGACCCTTGGTTCTACCCTTCTGCGCCTAGCTGAGATACACCGGCAAAACCAGCCTCGGATGCTGCTGGTGG
CCATTCATCACGCTCTCTACGACGGATGGTCAATGCCACTGCTCAAACAGGCAGTTGAGGATGTCTATCATGGAC
AGGAGTTGTGGCCACAGCCCTTCACCCCATTCATTAATTACCTAAATGAGGGAAAGCCGGCGGCACAAGGCTACT
GGACCGCCCACCTGGACGGCTTCGCAGGAAGCGTCTTCCCTAATTTGCCTAGCATAAACCACCATATCCAGCCGA
CGGAGCGTCGAACCCGCTCACTGGCCGTGCCGACAGCGCCCCCCGGATCGCAGTATACTATGGCGACAAAAATCC
AAGCAGCGTGGGCTGTCACGGTTTCGCGATATGCAGAGGCTGAGGACATTGTCTTTGGTACCGTTAGTACCGGTC
GTTCGGCACCTGTGCCGTCGATTGATCGCATGGTCGGTCCCACCATCACGACTGTGCCTGTTCGCATCTCGCTCG
GCAACCAGGCAGAGCGTCTCACCTCACTGCTGCAGAGGGTCCAAGAGGATGGCTGGAACAGGATGGATCATGAAC
ACCTGGGCCTCCAGCACATCCGCCGTCTCGGTGAATCTGCTGCTGCTGCTTGTAACCTCCAGACGCTGTTAGTAA
TTCAGCCTCGTGAAGAGCCTCGTGCCAAATCCATTTCCACCTTACTTTCAGGATTGCAAGACGTGGCTGAACTCA
AGGGCGTGGATACGTATCCGCTAATGTTGGTGTGCGAGCCTGATGGTGTCAGTCTGCATTTGACTGCCGTGTTTG
ATCCAGCCGTCCTGGACGCAGTCATGCTGGACCGGATGCTTGCTCATTGGGAGCTCGTTCTAAATCAAATATGGA
GTGAGCCGGACATGGCAGTGATGGGGCTTGATGGCGTATCATACAGGGATAAGCAGACATTGGTAAGATGGAATG
CTGGAGAAAAGATTGCTGATGGATGTGCCCATGACGCGGTGTATGAGTGGAGTGTCCGCACCCCTCATGCACCCG
CTGTCTTCGCTTGGGATGGTAAATGGACCTACGAGGAACTGGAGAAGTGCTCCTCTCTCATAGCCAGTCAGGTCC
TAGTCCATGGTGTCTCCTCCGGAGACTTTGTTGCTCTTTACCACGAGAAGTCTCGATGGGCGGCGGCCGCAATTC
TCGCGGTGTTCAAAGCCGGCGGCATCCTGGTTACCTTGGACCCGGCCCATCCCAAAGACAGAATCAAGGATATCC
TGGATCAAGCACGGCCGCGACTCGTACTGACCTCTCAGTCTCTCCTCGATGAGGCTAGAGAACTTGAGACCCCGG
TCATGGTTGTACAGTTCGCAGCATCCCAACCAATGCCCGGAGAATGCTTCCCTCTACCCACAGTAAGCCCCACCC
AGGCTGCATATGCTCCGTTTACCTCTGGATCTACAGGTCGACCAAAAGGGATTCCATTAGAGCATCGGGGACTGG
CTGCTTCAACTGCTTCAGTAGCTCGTGCCTGCCTACTGCGCCCAGCATCCCGAGTCCTTCATTTTGCCAGCTTCG
CCTTTGATGCCAGTATGATGGAGCACCTGATAGCCTGGCACGCCGGCAGCTGTCTCTGTATCCCGGTTGAAACTG
TCAGGCAGACGGATCTGGCCAGGTGCATACGAGACTTCGAAGTTACTTGGGCTTTTCTCACACCTTCATGCCTAC
GGCTAATCTCCCCCGATGATGTTCAGTCCCTTGAAGCCCTGGGTCTAGGTGGTGAGTCTATGACGCCCGAGGATA
TTTTCATCTGGGGTCCGCGACTCCGCCAGATTGTCCAGCTATACGGCCCGGCGGAGTGTTCCATTGTGGCCGCGT
TGACAGAAGTTACCAAGCCATCGGAGAACCGATTGATAGGGAGACCCAATGCCTGTCGATGCTGGGTAGTTGACC
CACACAGCCCAGATCGCCTAGCGCCCCTAGGTGCTGTCGGAGAGCTGGTAATTGAGGGGATCACTGTCGGTCGGG
GTTATATTGACGATCCCGAGCGAACCACCCAAGCATTTATACCACCCCCTACATGGATTCAAACACTGTATCCGA
ATGAGCAACAGCCAAGTCGCCTCTATCGGACCGGTGATCTCGTACGGTATGCTGGTACGGACGGGAAGCTGACCT
TCATCGGGCGAAGGGACGGCCAACTCAAGCTTCACGGACAACGTATAGAGTTGGCGGACGTCGAAGCTCACCTCC
GTCCTCTAATACCCGGCACGCAGAAGGTTGTTGTAGAGATGGTTCACAGTGTGGGCAACCACCACCCCCTTTTAG
CTGCCTTTGTGGAAGAAATATTGACATCACAAGATCAAGTGGAGCAAGTGGTTAATCTATTGCACCCAAGTCAAA
CCCAATGTGCCCTGAATGTCAAGGCCATCGATAGTGCACTGTCCCAAACGGTTCCCCAATACATGATTCCTAGCA
TGTATCTACATATCTCCCGCCTGCCCCTAAGCGCATCTGGAAAGCTCAACCGTCGCCACCTGCGTAGGTTGGTCG
CAGAGTTTCCACGTCAGAGACTCAGTGAATACGCTGCTGGATCAGGCCTCGCAGTCCCGAACCGGCCGGCAACAG
CTCAGGAGCGTGAAATGCAGGCTATCTGGGCGCGAGTATTGTCAGTTGACCCGGACACAATCGGAGTCAACGAAG
ACTTTTTCCGCATCGGCGGCGACTCCATTTCCGGGATGCAGGTTGCCACGAGATGCAATGCGGCAGGCATGCATA
TCACCAGTGCGGATCTCTTCCAACACCGTACCATCGAGCAACTGATGCGCCATCTTAGTGCTAATGGAAAGACTG
GCTCCGCGTCAATCTCACTACCTCCAGAGCCGGTGGACGAGTGGGTTCCTCTTGCCCCCATCCAGCAACTCTTCT
TCGAAATCGCCCCACAGGGTCCAGATCACTTCAACCAGAGCCTGCTCCTGCGCACTAGCCGCCGGGTCAGTGCAG
AAAAACTCGCCGGAGGCCTAGATATTCTCGTGGGACGACATTCTATGCTACGCGCGAGATTTTGTCGCGATGATT
CCGGCCAATGGTCCCAGCAGGTAAGGTCGCGCGGCCCGTACCCTGCTAGTGCATTTTACCGGTTGACCACACACA
ACCACATCGCTCCTGAGTTGCTGTCGTCACTTCTTGCTGCGTCTCAGATGGCCTTGTCTATTCAAGAGGGGCCGC
TCTTAGCCGTTGATCTGGTGAATTTGACGGACGATACTCAGCTCGTCTACTTGGTGGCCCATCATCTCATTATCG
ACCTGGTCTCGTGGCGCATCTTGCACGCGGAATTGGAGGAATATCTGCAGACGGGCTCCTTCGCGTCCACCACAG
GCTCTGTCCCCTTCTTGACCTGGAGTCGAGCACAGGCCGAATACAGCGCTAATCACCTTACTCCCACACTTCCTC
TACCTGGCTTCCAGGAAGCAAACGATGGCTTCGATGCCTCGAGGTACTGGGGGATTTCTTGCGAGTCGAACACAT
TCGGGCAAACCTCCACTTCCACGTTCACCTTGGACCAGACTGTGACCGACCAACTCTTCGGCCCCGCTAACAACG
TGCTTGATACTCGACCAGCTGAAATTTTGCAAGCTGCCCTCTGGTACTCTTTCACTCAATCTCTCACCGACCGTC
CGGGTCCCAGCATCTACGTTGAAGGTCACGGGCGAGAACCGTGGACGGGTTCCATTGACCTTTCGGGAACGGTCG
GTTGGTTTACAACCATGTCTCCGCTAGTGTCCGCTCCGTGGGATAGCCTATCACAGACATCGATGCGGGACTTCC
TCGATGCGCTCAGCTATATCAAGGACCAGCGCCGACGCATTCCGGCTAACGGATGGGCGTACTTCACCTCACGAT
ATTTGAACGACGAAGGCAAGGTCGCGTATGGGCGCATGAAGCCGGTCGTGGAAATTCTGTTTAACTATATGGGCC
AGTACCAGGAGATGAACCGTGAGGACGCCATACTACAGCTGGCTGGCGATGGCATCCAGTCCGGTACCGGTGCTG
CAGACGTTGCGGACAACGTACCACGCTTTTCGTTGATCGACGTTAGCGCGTTCATCTCGAACGGATGTCTAACCT
TCCAGTTTATACTCCCTAAATCTTTGCAGCAGGACTCTCGACTGCAAGGGTGTTTTCAGGAATATGAACGCACTC
TCGTCGCCGCTGCTAATTCACTGTCAACTGAGGGCCCCCGCAAAACATTGGCCGACTTTCCCCTTATGCCTGCAC
TCACATACGATCAGCTAAGCCAGTGCCTTGATCATACGCTGCCTTCGATGGGTTTGTGTGCCCGTGACGTTGTGG
ACATCTATCCCTGCTCCCTGTGCAACAGGGAATGTTGTTGGCCCAGCTGCGCGATCGACAGGCATATCAGCAACG
ATTCAGATTCCAGGTTAAGTCTCGCGGGTCAACAGACCGACTCACATTAGAAAAGCTGAAGGACGCTTGGACTGA
AGTGATCAACCGGCATGACATCCTCCGTACTCTCCTTCTACCAGTTTCGGATTACAGCCACTTGGACCAAGTAGT
CATGGCCCCTGGCAGTCTTCAACATCTGGTTCGGATTAATGCGATGGACACCAATCCCACACAGGGCCTACCACA
CTCGATTAACATCACCAGCGACTCAACCGGCACTGTAATTTGCGAGTGGAATGTCAGTCACGCCTTGGTCGATGC
CATGTCGATTGCGGTCATTCAACAGGAGGTCAATGAGGCGCTGGAAGGGTCGCTGGGTCAGCATCAAAAAACACC
GCGATACGCAGATTACATCCAATGGCTTTCTCTGCAAGACAACACCGAGACACAGGCGTATTGGAAAAAGTACCT
CGAGGGAGTGGAGCCATGTCTCTTTCCAAAATTGGCTTCTTCGACTGACAAAGTCAACCCGGAAGGTACCATTTC
TGCCATTCGTGCCACCTGGACCCGCGATTCGCGGTTGGACAAGCTATGCCATACGCACGGTATCACATTGACAAA
CCTATTCCACATTGTCTGGTCCCTTCTTCTCAGCGCCTATCTAGGCACTGATAAGGTTTGCTTCGGCTATACGAC
CCTTGGTCGAGATGTGCCTGTCGACGGGGTAGAGAAGATGGTCGGCCCTCTAGTCAATGTTATTGCCACAACCAT
CCAACTTCAAGAGGACGATTCGATCTTGGATGCACTTCTCACTCATCAAACCCATCTCTCAAATAGTCTCCAACA
CCAGCATTATGCGTTGGCAGACGTGTATGCCTCTTTAGGTCTGGTCGGTTCTCAGCTGTTCAACACTATCGTGTC
TTTGCAGGATATATCTCACTTCGATGCCAACGACGAGCGGCCGACCAGGGTCGAAATGCTCCCTGCAAATGACGT
CTCAGAGGTATGTCCCAGAGCGATAGTCTACGAAACTCTCCATCTTTAATGACGCTAACCTTTACTACAGTATGA
TGTGGCTCTCAATATCGGTGTCGATCAATCTTCCATTCAAGTGGTCTGCAGCTACCGAACACTATCGCTGTCTGT
GGAGCAGGCCGACGCGCTACTGCGAACTACCTCCCATGTACTGGATGAAATCCTGAGGGATCCCAAGCAACCGCT
TCGGGACCTTGAGGTGATTAGCCCCCAGTGTAAAGAGCAACTCGTAAAGTGGAACGCTGCCATGCCTGCCCCGAC
CGATGAATACATCCATGAGAAGATTCAGGACCAATGCCGTCTCCACTCTTCCCGAGAAGCCGCTTGCGCCTGGGA
CGGCATATTTACGTTCGCTGAAGTTGACGACCTATCGTCACGTCTGGCAGCACGGCTTATTAGGATGGGGGTTAC
CTCCGGTCACATCATACCAATCTACTCACCCAAATCCCGATGGACGGTCATCGCCATTCTAGGAGTCCTAAAAAC
TGGGGCTGCCTTCACACTTCTAGAAACATCGCATCCGACGGCTCGACTGCGCGTTATATGCAATGAGATCAAGGC
TGATATAATAATCGCGCCAGCATCGCATGCCGTCCCAGCGGCAACTTTGGCTCCTATCCTAGTCGTGCTCGACAG
CATCACGTCGATGAGCCCCCAAGAATCAGATCTCTTACCAGCTGTGGGTATGCCACCGGCTGCAGAAGCTCTCGC
CTATCTCATCTTCACTTCAGGCTCCACAGGAAACCCCAAGGGGGTTATGGTCACTCATCAGAATTTGTGCAGTAA
TGCGTCTATAATGACAACATCTGTCAATATGACATCCGACAGCAGGGTGCTACATTTTGCATCCCATGCATTCGA
TGCGTGTCTTTGGGAAATATTTGGTGCCCTATTTGCCGGTGCTTGTCTGATCATCCCGTCCGAGTCAGAGACCAA
GGAAGATCTGGCTGGTTGTATCGAGCGCATGGTCGTCACTTGGGCATTTCTGACCCCTTCCGTCGCAAGGATCTT
AAAGCCAGAGGCCCTTCCCAGTCTCCGTAATTTAGTCCTGGGAGGCGAGCCGATAGCGGCCTCGGATTTAGATAT
GTGGCGGGGTCACGTACAGGTTGTGTGTGCCTATGGACCAACCGAAACCGCCATCCTCGCCAGTACGACCTCACC
CTCTACCTTTCCCAGCGATGGCAAGGATATCGGCGTGCCAACTGGTAGCTCCCTTTGGATTGTTGACAAGCAAAA
TTACAACAAGCTGGCACCTCATGGAGCCACAGGCGAGCTGCTGATTGAGGGCCCCAATGTGAGCCAAGGATATCT
TGGGGATCCAGAGAAAACCAATGAAGCCTTCCCAGTCGCTCCACGCTGGCTGTCACAGCTCCGAAAGTCGCCTAC
CAGGGTCTACCGAACTGGTGACTTGGTTCGCTTCAACACATCTACGGGCACCATTCACTTCGTTGGACGCAAGGA
TAACCAGATCAAGTTCCACGGACAGCGCATCGAGCTCGGTGACATCGAACATCATGCTCAGCAGGCCTTTTCGAA
TGCCAGCATGGTCATCGTCGATTTGATTACCCCTGAACAGCCTCAACAACCATATATTGTTGCTTTCGTACATCA
AGCAGATACAAGGACTGGAACGGCCGACCCAATTGACACCATCTTGCTTCCTCCCTCCGAATCCTTCCGAGCAGA
CGCAATAGGAGCGCAGAACCACATGCACAAACGACTCCCGCACTACATGGTCCCAACAGCTTTCCTCCCTTTGCA
TCGGCTTCCTCTATCAGGCACTGGCAAAGCCGATCGCAAGCGCCTCCGACAATGTGCACTCTCTCTGTCCAGCCT
TGAGCTCAATGCATATCGCGCCACAGCCTCCGCGAAGCGTATGCCTTTCACCGCAGCGGAGTGCAAAATGCAGGA
ATTGGTTGCAACTGTTCTGGGAAGGGACATGTCCGAGATTGGCATGGATGACAGCTTTTTCTATCTGGGAGGTGA
CTCCATACAAGCAATGCGCCTGGTTTCTGAGGGTCGTCAACAAGGCCTTACCCTCTCCCTTCAAGCAATCTTTGA
CGCTCCCCGTCTGGGTGACCTTGCTTATCGGACAGCCAACCTGGTCAGAGTGAGCGAGCCAGCCCCGCCCACATT
GCCAGCCACCTCAAGTGATGATTGCGACCATAAAGAGACAATAGTTGCAGCTCTGCCCATCAAGAAGACTGACGT
GGCCGAAGTCCTTCCCACAACCTCTTTTCAGCGCACCTGGCTAGACTCACAGCTGAAGAGCTACATTGTCGTCGA
CATCCCAGGCCCGATCGATCTTGCACGTCTCCGTACGGCCATACAGCGGGTCGTGAAGGCGCACCCTATTCTCCG
AGCGTCCTTCGTGCCTTATGAAACCACAACCATGCAAGTTATCCTCCGCACAGCAGTGGTCATCACAGAGGCCGA
CCTGTCCACCACTACCGTGGAAGGCATTTGCCGCAAGGATGCAAATGCCCCAATGGCCCCTGGAACGCCGTATCT
GCGCGTCATCCTAGCAACTCAAGGAGAAGTAGATCGTAAACTGATCATGCGACTTTCTCACGCCCAATACGATGG
TATCTCACTCTCCCTACTCATGAATGATCTGAGTCACGCATACGCAAGCGAGTCTCGTCCATTACCTTCATCCCA
CTTGCCCGCGTTCAACGACTATATTACCTATCAGCAAACTCAGGGAGCCGACCCCACAGCGACCACATTCTGGCA
TCGTCTCCTCAAAGACGTGCCAATTACCTACCTTGATCTCCAACCAGCCGAGACCCCAACCAGCAATGGATCCCT
CATTACACGTACCCGCGACATTAATATTGCTGCCTTCCCATCACTCCCTAACGGTATCACCACAGCCACAGCTGT
CAAGGCAGCCTGGTCGCTGGTCCTAGCCCAGAAGACTGGTTCCCTTGCCGTTATATTTGGCCAGGTTGTCCATGG
TCGGGGAATTGCGCTTACCGGGGTTGAGGGTATTGTCGGTCCTTGTGCTAATATTACGCCCGTCGTTGCACGCCT
GGGTCCTCAAACTACAAGAATGGAGTTAATGCAAACGTTGCAAGACCAACACCGCTCTGCTATGCCATATGAGAC
GGTAAGTCTGGATGACGCGCTGGCTTATACTAAGGACTCGCAGGCCGGGCGTAAAGAGTTGCAAACAATCGTGCA
GCATCAGAATAATGTGATGGCTGACGATATGGAACTGTCGCTTGGAGAGGCAAGGTGTCGGGTCGATCTGAGGGC
AGTGGATCATGTGCCACAAGAGGTATGGGTATATTCGTCTATCGATGGGGGAAGACCGGGTATGTTGGAGGTGAA
GATCATGTCGTCGACGTTGGTGTTGAGTGAGGAGGTTGCGGAAGAGTTGATGGATTTGCTTGTAGAGATGATGAA
GAGGTTGTTTAGCGATCCTGAGGGTGTGTGTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail