Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4620.t1
Gene name
Locationscaffold_024:17506..18405
Strand-
Gene length (bp)899
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein 9.7E-14 30 232

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 59 78 19
3 105 127 22
4 134 151 17
5 156 178 22
6 190 208 18
7 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4620.t1
MSLFMRASDALNVNPVAGVDEALSVHGSDWLWAITAIYIVSFLGLLTMSFSGKESERVFHYLFTFLLLVGAITYY
AQASDLGWSAVEQVNNLDNGAIRQMFWAKYVNWVVAFPSLALALGLVSGVSWTTMICNIALACYWVTSYLVSAYT
PSTYKWGFFAFGTLSWGILAMSTINESREAAQRLGVDRDYIILSGWCNLLWLLYPVAWGLSDGGNVIGITEATIF
FGILDILMVPLLTFMFLFFARNWDYQKLSIAFSDARPSREAQSPKQQQVAESSPSA*
Coding >Ani_SJS100_1|g4620.t1
ATGAGTCTCTTCATGCGAGCAAGCGATGCTCTCAACGTCAACCCAGTTGCAGGCGTTGATGAAGCCCTATCTGTG
CATGGATCCGACTGGCTTTGGGCTATCACAGCCATCTATATTGTATCATTCCTTGGCCTCCTGACAATGTCCTTC
TCCGGAAAAGAAAGTGAACGAGTATTCCACTACCTCTTCACCTTTCTCCTCCTAGTCGGCGCAATAACCTACTAC
GCCCAAGCCTCTGATCTCGGCTGGAGCGCTGTGGAACAAGTCAACAATCTCGACAACGGAGCAATACGCCAGATG
TTCTGGGCAAAATACGTCAACTGGGTTGTTGCATTCCCTTCACTCGCCCTTGCACTCGGTCTCGTCTCAGGGGTT
TCATGGACGACCATGATCTGCAATATCGCACTTGCCTGCTATTGGGTCACCAGCTACCTCGTGTCCGCATACACG
CCCTCAACCTACAAATGGGGGTTTTTCGCTTTTGGAACCCTATCCTGGGGGATTCTCGCCATGAGCACTATAAAC
GAGAGTCGGGAAGCCGCGCAACGGCTTGGGGTGGATCGTGATTACATTATTCTCTCTGGGTGGTGCAACCTGCTT
TGGCTTTTGTACCCTGTGGCCTGGGGTTTGAGTGATGGGGGGAATGTTATTGGGATCACAGAAGCCACTATTTTC
TTTGGGATTCTTGATATCCTCATGGTGCCGCTTTTGACATTTATGTTTCTTTTCTTTGCACGGAATTGGGATTAT
CAGAAGTTGAGTATTGCCTTTAGTGATGCGAGGCCGAGTCGGGAGGCACAGAGTCCTAAGCAGCAGCAGGTGGCA
GAGAGTAGTCCTTCTGCTTAG
Transcript >Ani_SJS100_1|g4620.t1
ATGAGTCTCTTCATGCGAGCAAGCGATGCTCTCAACGTCAACCCAGTTGCAGGCGTTGATGAAGCCCTATCTGTG
CATGGATCCGACTGGCTTTGGGCTATCACAGCCATCTATATTGTATCATTCCTTGGCCTCCTGACAATGTCCTTC
TCCGGAAAAGAAAGTGAACGAGTATTCCACTACCTCTTCACCTTTCTCCTCCTAGTCGGCGCAATAACCTACTAC
GCCCAAGCCTCTGATCTCGGCTGGAGCGCTGTGGAACAAGTCAACAATCTCGACAACGGAGCAATACGCCAGATG
TTCTGGGCAAAATACGTCAACTGGGTTGTTGCATTCCCTTCACTCGCCCTTGCACTCGGTCTCGTCTCAGGGGTT
TCATGGACGACCATGATCTGCAATATCGCACTTGCCTGCTATTGGGTCACCAGCTACCTCGTGTCCGCATACACG
CCCTCAACCTACAAATGGGGGTTTTTCGCTTTTGGAACCCTATCCTGGGGGATTCTCGCCATGAGCACTATAAAC
GAGAGTCGGGAAGCCGCGCAACGGCTTGGGGTGGATCGTGATTACATTATTCTCTCTGGGTGGTGCAACCTGCTT
TGGCTTTTGTACCCTGTGGCCTGGGGTTTGAGTGATGGGGGGAATGTTATTGGGATCACAGAAGCCACTATTTTC
TTTGGGATTCTTGATATCCTCATGGTGCCGCTTTTGACATTTATGTTTCTTTTCTTTGCACGGAATTGGGATTAT
CAGAAGTTGAGTATTGCCTTTAGTGATGCGAGGCCGAGTCGGGAGGCACAGAGTCCTAAGCAGCAGCAGGTGGCA
GAGAGTAGTCCTTCTGCTTAG
Gene >Ani_SJS100_1|g4620.t1
ATGAGTCTCTTCATGCGAGCAAGCGATGCTCTCAACGTCAACCCAGTTGCAGGCGTTGATGAAGCCCTATCTGTG
CATGGATCCGACTGGCTTTGGGCTATCACAGCCATCTATATTGTATCATTCGTGAGTCATTTTTGTACTCTAATT
TTAATTTCACCTATTGACATTAAACATAGCTTGGCCTCCTGACAATGTCCTTCTCCGGAAAAGAAAGTGAACGAG
TATTCCACTACCTCTTCACCTTTCTCCTCCTAGTCGGCGCAATAACCTACTACGCCCAAGCCTCTGATCTCGGCT
GGAGCGCTGTGGAACAAGTCAACAATCTCGACAACGGAGCAATACGCCAGATGTTCTGGGCAAAATACGTCAACT
GGGTTGTTGCATTCCCTTCACTCGCCCTTGCACTCGGTCTCGTCTCAGGGGTTTCATGGACGACCATGATCTGCA
ATATCGCACTTGCCTGCTATTGGGTCACCAGCTACCTCGTGTCCGCATACACGCCCTCAACCTACAAATGGGGGT
TTTTCGCTTTTGGAACCCTATCCTGGGGGATTCTCGCCATGAGCACTATAAACGAGAGTCGGGAAGCCGCGCAAC
GGCTTGGGGTGGATCGTGATTACATTATTCTCTCTGGGTGGTGCAACCTGCTTTGGCTTTTGTACCCTGTGGCCT
GGGGTTTGAGTGATGGGGGGAATGTTATTGGGATCACAGAAGCCACTATTTTCTTTGGGATTCTTGATATCCTCA
TGGTGCCGCTTTTGACATTTATGTTTCTTTTCTTTGCACGGAATTGGGATTATCAGAAGTTGAGTATTGCCTTTA
GTGATGCGAGGCCGAGTCGGGAGGCACAGAGTCCTAAGCAGCAGCAGGTGGCAGAGAGTAGTCCTTCTGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail