Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4616.t1
Gene name
Locationscaffold_023:408587..412508
Strand+
Gene length (bp)3921
Transcript length (bp)3594
Coding sequence length (bp)3594
Protein length (aa) 1198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain 7.4E-46 504 644
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 5.9E-08 890 972

GO

GO Term Description Terminal node
GO:0003964 RNA-directed DNA polymerase activity Yes
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034061 DNA polymerase activity No
GO:0016740 transferase activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016779 nucleotidyltransferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4616.t1
MGKKRKRPIKGDRALDRLSQPCTSPASTCFKGLRSLARDDAAEHSHPVISLYYSQVVTLRQYLLCQIPLSSKSRR
RRIVSICHEPAPAKTSDDGGSGGLLANLLNTTLVGILTDSPPTCNEKRRQELAAFTQSQSKSEQASTDTGPLCAQ
AELVDFVISSLFNRDRFSRQKPLHLLTRGYRRVSAHPAHYGNRTVSCSIAGLEVQFPNDNVQQLKQAPWTEVLGL
LGDNGEEIMLKLLLDCGIFVAVDQKRGIYFQLSGLPLSTLEPVNKVPQNHLIPKNALPLSVTSKPATIQKPAPIV
FHRRRILYASPVLDLKGKIQFGMKGMKSHVLNRFSSSTSLTHTAHVLKYIFPKQFGLHNVFSSVSSGQDMQFKDY
TYREDEIAKLEKAKRAHTSQITIPRRLQGKAIELVQQLQNRNKHCSYTYLLNYYCPAEHIGPWKLGPEPFHDTNL
LAPEFLITQPRLSCQQVSCSSVLDGGHSTLNPGDMSKIRAPKLSLTDYATPAASVSAFCRAALRNLIPPQFYGTG
QNRIRHQEKILKHVDQFVRMRRFENLSLQDVCQGIKVTCIPWLEPTSSRQVFNLLQNKLSRSDFEKRTELLHEFV
YYLFDSILIPLIRANFYVTETQSHRNRLFYFRHDVWRQLTEGPMVELKASVFEELEPAIAQRIVEKRLEKSGMGY
GSLRLLPKSTGIRPLLNLKRRSLLAGHGKPGKFWSVNSVVAPIHSMLQYEKTRAPSKLGSCVQSVGEIHSQLKIF
KKHLSPNQGSMPPLYFVKLDIQSCFDTIPQQSLIHVIEGLITEAAYHYTKHVEMTPSDEFNVLWPSHEARPSKAR
RRFVGRAAPAARPQHLAEAVTNGETSQRRNTVFVDTLMQREFNAEDLLDLLDDHVRNNLIKFGRNYFRQRNGIPQ
GSVLSSMLCNLFYADMEQQVLGFLQSDKALLVRLVDDFLLVTTDSSLAMRFLQVMIPGQPAYGVSVNPAKSLVNF
AAAVDGIQIPRLVDTRLFPYCGSLIDTRSLEIYKDHERILEGGQSVATSLSNSLTIEVTRAPGRTLHRKLLGSFK
LLMHPMYLDRQHNTIGVILSNLYANFVISAMKMYRYLKSLSGRVHPAPVVIRIVRDVIHLATRMVQARREANLPP
AASRRGVHQCEVEYLAAAAFRFVLGRKQARYVRVLGWLDVILRESQPNSKTQAWQLGQVVRTGNATYGGWKF*
Coding >Ani_SJS100_1|g4616.t1
ATGGGCAAGAAGAGGAAGAGACCCATCAAGGGTGACCGTGCGCTGGACAGGTTGTCGCAGCCATGCACCTCTCCA
GCATCCACTTGTTTCAAGGGACTGCGCAGCCTCGCTCGTGATGATGCTGCAGAGCACTCGCATCCAGTCATCTCA
TTATACTATTCTCAGGTTGTAACACTGAGACAATATCTTCTATGCCAAATACCCCTGTCCTCCAAATCTCGCCGT
CGGAGAATTGTGTCAATATGTCATGAGCCGGCTCCTGCAAAGACAAGTGACGATGGTGGTTCAGGAGGACTACTT
GCCAATCTTCTTAATACGACCCTGGTGGGTATATTGACCGACTCGCCTCCGACATGCAACGAAAAACGCCGGCAA
GAGCTAGCCGCGTTTACGCAGTCGCAGTCTAAATCTGAACAAGCCAGCACAGACACCGGACCATTATGTGCCCAG
GCAGAGCTTGTTGATTTTGTCATATCCTCCCTGTTTAATCGTGACAGATTCTCACGTCAAAAGCCCCTTCATCTA
TTAACCCGAGGATACAGACGCGTGAGCGCGCACCCTGCTCATTATGGGAATAGGACAGTATCATGCAGTATTGCA
GGCCTTGAGGTGCAGTTCCCTAATGACAATGTCCAGCAACTGAAGCAAGCACCATGGACAGAAGTGCTTGGATTA
TTGGGGGACAATGGAGAAGAGATCATGCTAAAGCTTCTCCTGGACTGTGGTATATTTGTGGCCGTTGATCAGAAA
AGAGGAATCTATTTCCAATTAAGTGGGCTCCCTCTATCGACCCTTGAACCCGTGAATAAGGTGCCCCAAAACCAT
TTGATACCAAAGAATGCACTTCCTCTCTCAGTAACAAGCAAGCCTGCGACTATACAAAAGCCAGCTCCTATTGTT
TTCCATCGCCGACGAATTTTGTATGCTTCACCAGTGCTCGATCTGAAAGGAAAGATTCAGTTTGGAATGAAAGGA
ATGAAAAGCCATGTTTTGAACCGCTTTTCCTCTTCTACATCACTCACGCACACTGCTCACGTATTGAAATACATA
TTCCCCAAACAATTCGGCTTGCATAATGTCTTCTCGAGCGTGTCGAGTGGCCAAGACATGCAGTTCAAAGATTAC
ACTTATCGCGAAGATGAGATTGCAAAATTAGAGAAAGCAAAGCGAGCCCATACCTCCCAGATCACGATCCCAAGA
CGACTCCAAGGCAAAGCTATAGAGTTGGTCCAGCAGCTGCAGAACCGGAATAAACATTGCTCATATACATATTTA
CTCAATTACTACTGTCCCGCCGAGCATATTGGCCCGTGGAAACTTGGCCCTGAGCCCTTTCATGATACCAATTTG
TTAGCGCCAGAGTTTTTGATCACCCAACCCCGGCTGTCCTGTCAGCAGGTATCTTGTTCTTCAGTTTTGGATGGT
GGTCACTCAACTTTGAATCCTGGCGACATGTCAAAAATACGAGCACCGAAGCTCAGTTTGACAGACTACGCGACG
CCTGCAGCATCCGTATCTGCCTTCTGTAGAGCTGCCTTGAGGAATCTGATTCCCCCCCAATTTTACGGAACTGGT
CAGAACAGGATCCGGCATCAAGAAAAAATTCTCAAGCATGTCGATCAATTCGTGCGAATGCGGCGTTTCGAAAAC
CTGAGTCTTCAAGATGTGTGCCAGGGAATCAAGGTCACTTGTATACCTTGGCTTGAGCCTACTAGTTCAAGACAA
GTATTCAATCTCTTGCAGAACAAGCTGTCCAGGTCCGACTTCGAGAAGCGAACAGAGCTACTTCATGAGTTCGTG
TACTATCTGTTCGACTCCATTCTAATACCACTCATCCGAGCCAACTTTTATGTCACCGAGACCCAGTCTCATCGA
AACCGTCTGTTCTATTTCCGGCACGACGTGTGGCGCCAGCTGACTGAAGGACCGATGGTTGAGCTCAAGGCTAGC
GTTTTTGAAGAGCTGGAGCCAGCCATAGCTCAGCGTATAGTAGAAAAGAGATTAGAGAAAAGCGGTATGGGATAT
GGTTCATTACGACTATTACCTAAATCAACAGGTATTCGCCCTCTGTTGAATCTCAAGCGAAGATCTTTATTAGCT
GGCCATGGAAAACCCGGCAAGTTCTGGAGCGTCAACTCAGTTGTTGCCCCGATCCACAGCATGCTCCAGTATGAG
AAAACACGAGCACCGTCCAAACTAGGCTCATGTGTGCAGTCGGTGGGGGAGATACATTCTCAATTGAAGATATTC
AAGAAACACCTATCACCAAATCAGGGCTCGATGCCTCCATTATACTTTGTCAAGCTTGATATCCAATCTTGCTTT
GACACAATCCCTCAACAGAGCCTGATCCATGTTATCGAAGGGCTGATCACCGAAGCAGCCTATCATTACACAAAA
CACGTTGAAATGACGCCGTCTGATGAATTCAACGTCCTGTGGCCATCGCACGAAGCCCGGCCAAGCAAGGCTAGG
CGGCGATTTGTCGGTAGGGCAGCGCCTGCTGCAAGGCCACAGCACCTGGCAGAGGCGGTGACAAACGGCGAGACC
AGCCAGAGGCGAAACACCGTCTTTGTCGACACCCTCATGCAGAGAGAATTCAATGCGGAAGATTTACTGGACCTC
CTTGATGACCACGTGCGAAACAATCTCATCAAGTTCGGGCGGAATTACTTTCGGCAACGCAATGGCATTCCCCAG
GGCTCAGTGTTATCGAGCATGTTGTGCAACCTTTTCTATGCAGACATGGAGCAGCAAGTGCTGGGATTTCTGCAG
TCAGACAAAGCTTTACTGGTTCGCCTAGTTGATGATTTTCTACTCGTCACTACCGACTCCTCATTGGCCATGCGT
TTTCTCCAGGTCATGATCCCCGGGCAGCCTGCGTACGGGGTTTCGGTCAATCCAGCTAAAAGCCTGGTCAACTTC
GCCGCCGCTGTGGACGGGATTCAAATCCCGCGCCTCGTGGATACTCGGCTCTTCCCTTACTGCGGAAGTCTGATC
GATACTCGTTCTTTGGAGATCTACAAGGATCATGAGCGCATCCTGGAAGGGGGCCAATCAGTCGCCACCAGTCTC
TCGAACTCGCTCACCATCGAGGTGACGCGAGCACCGGGCCGGACTCTTCACCGCAAACTGCTTGGGTCCTTCAAG
CTGCTCATGCATCCCATGTACTTGGATAGGCAACACAACACGATCGGAGTGATCCTATCGAACCTGTACGCGAAC
TTCGTCATATCGGCGATGAAGATGTACCGATACTTGAAGTCGCTGTCGGGGCGGGTCCACCCAGCGCCCGTGGTG
ATTCGAATCGTTCGAGATGTGATACACCTAGCCACCCGCATGGTCCAAGCCCGACGTGAGGCGAACTTACCACCA
GCAGCTAGTCGTCGCGGGGTGCATCAGTGCGAGGTTGAATACTTGGCTGCCGCGGCGTTCCGGTTTGTGCTGGGA
CGCAAGCAAGCCCGGTACGTGCGGGTGTTAGGCTGGCTGGATGTCATTCTCAGAGAGAGCCAGCCCAATTCCAAG
ACACAGGCCTGGCAGCTAGGGCAGGTGGTGCGAACTGGCAATGCGACATATGGCGGCTGGAAGTTCTAG
Transcript >Ani_SJS100_1|g4616.t1
ATGGGCAAGAAGAGGAAGAGACCCATCAAGGGTGACCGTGCGCTGGACAGGTTGTCGCAGCCATGCACCTCTCCA
GCATCCACTTGTTTCAAGGGACTGCGCAGCCTCGCTCGTGATGATGCTGCAGAGCACTCGCATCCAGTCATCTCA
TTATACTATTCTCAGGTTGTAACACTGAGACAATATCTTCTATGCCAAATACCCCTGTCCTCCAAATCTCGCCGT
CGGAGAATTGTGTCAATATGTCATGAGCCGGCTCCTGCAAAGACAAGTGACGATGGTGGTTCAGGAGGACTACTT
GCCAATCTTCTTAATACGACCCTGGTGGGTATATTGACCGACTCGCCTCCGACATGCAACGAAAAACGCCGGCAA
GAGCTAGCCGCGTTTACGCAGTCGCAGTCTAAATCTGAACAAGCCAGCACAGACACCGGACCATTATGTGCCCAG
GCAGAGCTTGTTGATTTTGTCATATCCTCCCTGTTTAATCGTGACAGATTCTCACGTCAAAAGCCCCTTCATCTA
TTAACCCGAGGATACAGACGCGTGAGCGCGCACCCTGCTCATTATGGGAATAGGACAGTATCATGCAGTATTGCA
GGCCTTGAGGTGCAGTTCCCTAATGACAATGTCCAGCAACTGAAGCAAGCACCATGGACAGAAGTGCTTGGATTA
TTGGGGGACAATGGAGAAGAGATCATGCTAAAGCTTCTCCTGGACTGTGGTATATTTGTGGCCGTTGATCAGAAA
AGAGGAATCTATTTCCAATTAAGTGGGCTCCCTCTATCGACCCTTGAACCCGTGAATAAGGTGCCCCAAAACCAT
TTGATACCAAAGAATGCACTTCCTCTCTCAGTAACAAGCAAGCCTGCGACTATACAAAAGCCAGCTCCTATTGTT
TTCCATCGCCGACGAATTTTGTATGCTTCACCAGTGCTCGATCTGAAAGGAAAGATTCAGTTTGGAATGAAAGGA
ATGAAAAGCCATGTTTTGAACCGCTTTTCCTCTTCTACATCACTCACGCACACTGCTCACGTATTGAAATACATA
TTCCCCAAACAATTCGGCTTGCATAATGTCTTCTCGAGCGTGTCGAGTGGCCAAGACATGCAGTTCAAAGATTAC
ACTTATCGCGAAGATGAGATTGCAAAATTAGAGAAAGCAAAGCGAGCCCATACCTCCCAGATCACGATCCCAAGA
CGACTCCAAGGCAAAGCTATAGAGTTGGTCCAGCAGCTGCAGAACCGGAATAAACATTGCTCATATACATATTTA
CTCAATTACTACTGTCCCGCCGAGCATATTGGCCCGTGGAAACTTGGCCCTGAGCCCTTTCATGATACCAATTTG
TTAGCGCCAGAGTTTTTGATCACCCAACCCCGGCTGTCCTGTCAGCAGGTATCTTGTTCTTCAGTTTTGGATGGT
GGTCACTCAACTTTGAATCCTGGCGACATGTCAAAAATACGAGCACCGAAGCTCAGTTTGACAGACTACGCGACG
CCTGCAGCATCCGTATCTGCCTTCTGTAGAGCTGCCTTGAGGAATCTGATTCCCCCCCAATTTTACGGAACTGGT
CAGAACAGGATCCGGCATCAAGAAAAAATTCTCAAGCATGTCGATCAATTCGTGCGAATGCGGCGTTTCGAAAAC
CTGAGTCTTCAAGATGTGTGCCAGGGAATCAAGGTCACTTGTATACCTTGGCTTGAGCCTACTAGTTCAAGACAA
GTATTCAATCTCTTGCAGAACAAGCTGTCCAGGTCCGACTTCGAGAAGCGAACAGAGCTACTTCATGAGTTCGTG
TACTATCTGTTCGACTCCATTCTAATACCACTCATCCGAGCCAACTTTTATGTCACCGAGACCCAGTCTCATCGA
AACCGTCTGTTCTATTTCCGGCACGACGTGTGGCGCCAGCTGACTGAAGGACCGATGGTTGAGCTCAAGGCTAGC
GTTTTTGAAGAGCTGGAGCCAGCCATAGCTCAGCGTATAGTAGAAAAGAGATTAGAGAAAAGCGGTATGGGATAT
GGTTCATTACGACTATTACCTAAATCAACAGGTATTCGCCCTCTGTTGAATCTCAAGCGAAGATCTTTATTAGCT
GGCCATGGAAAACCCGGCAAGTTCTGGAGCGTCAACTCAGTTGTTGCCCCGATCCACAGCATGCTCCAGTATGAG
AAAACACGAGCACCGTCCAAACTAGGCTCATGTGTGCAGTCGGTGGGGGAGATACATTCTCAATTGAAGATATTC
AAGAAACACCTATCACCAAATCAGGGCTCGATGCCTCCATTATACTTTGTCAAGCTTGATATCCAATCTTGCTTT
GACACAATCCCTCAACAGAGCCTGATCCATGTTATCGAAGGGCTGATCACCGAAGCAGCCTATCATTACACAAAA
CACGTTGAAATGACGCCGTCTGATGAATTCAACGTCCTGTGGCCATCGCACGAAGCCCGGCCAAGCAAGGCTAGG
CGGCGATTTGTCGGTAGGGCAGCGCCTGCTGCAAGGCCACAGCACCTGGCAGAGGCGGTGACAAACGGCGAGACC
AGCCAGAGGCGAAACACCGTCTTTGTCGACACCCTCATGCAGAGAGAATTCAATGCGGAAGATTTACTGGACCTC
CTTGATGACCACGTGCGAAACAATCTCATCAAGTTCGGGCGGAATTACTTTCGGCAACGCAATGGCATTCCCCAG
GGCTCAGTGTTATCGAGCATGTTGTGCAACCTTTTCTATGCAGACATGGAGCAGCAAGTGCTGGGATTTCTGCAG
TCAGACAAAGCTTTACTGGTTCGCCTAGTTGATGATTTTCTACTCGTCACTACCGACTCCTCATTGGCCATGCGT
TTTCTCCAGGTCATGATCCCCGGGCAGCCTGCGTACGGGGTTTCGGTCAATCCAGCTAAAAGCCTGGTCAACTTC
GCCGCCGCTGTGGACGGGATTCAAATCCCGCGCCTCGTGGATACTCGGCTCTTCCCTTACTGCGGAAGTCTGATC
GATACTCGTTCTTTGGAGATCTACAAGGATCATGAGCGCATCCTGGAAGGGGGCCAATCAGTCGCCACCAGTCTC
TCGAACTCGCTCACCATCGAGGTGACGCGAGCACCGGGCCGGACTCTTCACCGCAAACTGCTTGGGTCCTTCAAG
CTGCTCATGCATCCCATGTACTTGGATAGGCAACACAACACGATCGGAGTGATCCTATCGAACCTGTACGCGAAC
TTCGTCATATCGGCGATGAAGATGTACCGATACTTGAAGTCGCTGTCGGGGCGGGTCCACCCAGCGCCCGTGGTG
ATTCGAATCGTTCGAGATGTGATACACCTAGCCACCCGCATGGTCCAAGCCCGACGTGAGGCGAACTTACCACCA
GCAGCTAGTCGTCGCGGGGTGCATCAGTGCGAGGTTGAATACTTGGCTGCCGCGGCGTTCCGGTTTGTGCTGGGA
CGCAAGCAAGCCCGGTACGTGCGGGTGTTAGGCTGGCTGGATGTCATTCTCAGAGAGAGCCAGCCCAATTCCAAG
ACACAGGCCTGGCAGCTAGGGCAGGTGGTGCGAACTGGCAATGCGACATATGGCGGCTGGAAGTTCTAG
Gene >Ani_SJS100_1|g4616.t1
ATGGGCAAGAAGAGGAAGAGACCCATCAAGGGTGACCGTGCGCTGGACAGGTTGTCGCAGCCATGCACCTCTCCA
GCATCCACTTGTTTCAAGGGACTGCGCAGCCTCGCTCGTGATGATGCTGCAGAGCACTCGCATCCAGTCATCTCA
TTATACTATTCTCAGGTTGTAACACTGAGACAATATCTTCTATGCCAAATACCCCTGTCCTCCAAATCTCGCCGT
CGGAGAATTGTGTCAATATGTCATGAGCCGGCTCCTGCAAAGACAAGTGACGATGGTGGTTCAGGAGGACTACTT
GCCAATCTTCTTAATACGACCCTGGTGGGTATATTGACCGACTCGCCTCCGACATGCAACGAAAAACGCCGGCAA
GAGCTAGCCGCGTTTACGCAGTCGCAGTCTAAATCTGAACAAGCCAGCACAGACACCGGACCATTATGTGCCCAG
GCAGAGGTATGATACATTCTGGAGTTTATGTATAGGAAATTTCCTGAGTATACACTGACGCTATATTATAGCTTG
TTGATTTTGTCATATCCTCCCTGTTTAATCGTGACAGATTCTCACGTCAAAAGCCCCTTCATCTATTAACCCGAG
GATACAGACGCGTGAGCGCGCACCCTGCTCATTATGGGAATAGGACAGTATCATGCAGTATTGCAGGCCTTGAGG
TGCAGTTCCCTAATGACAATGTCCAGCAACTGAAGCAAGCACCATGGACAGAAGTGCTTGGATTATTGGGGGACA
ATGGAGAAGAGATCATGCTAAAGCTTCTCCTGGACTGTGGTATATTTGTGGCCGTTGATCAGAAAAGAGGAATCT
ATTTCCAATTAAGTGGTAAGCAGGCTGCTTTGGCAGGCGTATACATATACTAAGATGGTAATCTAGGGCTCCCTC
TATCGACCCTTGAACCCGTGAATAAGGTGCCCCAAAACCATTTGATACCAAAGAATGCACTTCCTCTCTCAGTAA
CAAGCAAGCCTGTACTGGCCCCTGATCTCATTAAAGAGATTAAAACTGACAAGAGTACTTCTGACCACAAGGCGA
CTATACAAAAGCCAGCTCCTATTGTTTTCCATCGCCGACGAATTTTGTATGCTTCACCAGTGCTCGATCTGAAAG
GAAAGATTCAGTTTGGAATGAAAGGAATGAAAAGCCGTAAGTACAGAGAGATCAACTGTTTGGCGCCTCTTAACT
GATAATATAGATGTTTTGAACCGCTTTTCCTCTTCTACATCACTCACGCACACTGCTCACGTATTGAAATACATA
TTCCCCAAACAATTCGGCTTGCATAATGTCTTCTCGAGCGTGTCGAGTGGCCAAGACATGCAGTTCAAAGATTAC
ACTTATCGCGAAGATGAGATTGCAAAATTAGAGAAAGCAAAGCGAGCCCATACCTCCCAGATCACGATCCCAAGA
CGACTCCAAGGCAAAGCTATAGAGTTGGTCCAGCAGCTGCAGAACCGGAATAAACATTGCTCATATACATATTTA
CTCAATTACTACTGTCCCGCCGAGGTATGCTCGCAGGCCCACCTATAAGATTTTAAGCTAACGTTTACTATTTAG
CATATTGGCCCGTGGAAACTTGGCCCTGAGCCCTTTCATGATACCAATTTGTTAGCGCCAGAGTTTTTGATCACC
CAACCCCGGCTGTCCTGTCAGCAGGTATCTTGTTCTTCAGTTTTGGATGGTGGTCACTCAACTTTGAATCCTGGC
GACATGTCAAAAATACGAGCACCGAAGCTCAGTTTGACAGACTACGCGACGCCTGCAGCATCCGTATCTGCCTTC
TGTAGAGCTGCCTTGAGGAATCTGATTCCCCCCCAATTTTACGGAACTGGTCAGAACAGGATCCGGCATCAAGAA
AAAATTCTCAAGCATGTCGATCAATTCGTGCGAATGCGGCGTTTCGAAAACCTGAGTCTTCAAGATGTGTGCCAG
GGAATCAAGGTTCGTTGACAACCACGTCCCTGTCTTCCAATACTAATAATCTATCTTCAGGTCACTTGTATACCT
TGGCTTGAGCCTACTAGTTCAAGACAAGTATTCAATCTCTTGCAGAACAAGCTGTCCAGGTCCGACTTCGAGAAG
CGAACAGAGCTACTTCATGAGTTCGTGTACTATCTGTTCGACTCCATTCTAATACCACTCATCCGAGCCAACTTT
TATGTCACCGAGACCCAGTCTCATCGAAACCGTCTGTTCTATTTCCGGCACGACGTGTGGCGCCAGCTGACTGAA
GGACCGATGGTTGAGCTCAAGGCTAGCGTTTTTGAAGAGCTGGAGCCAGCCATAGCTCAGCGTATAGTAGAAAAG
AGATTAGAGAAAAGCGGTATGGGATATGGTTCATTACGACTATTACCTAAATCAACAGGTATTCGCCCTCTGTTG
AATCTCAAGCGAAGATCTTTATTAGCTGGCCATGGAAAACCCGGCAAGTTCTGGAGCGTCAACTCAGTTGTTGCC
CCGATCCACAGCATGCTCCAGTATGAGAAAACACGAGCACCGTCCAAACTAGGCTCATGTGTGCAGTCGGTGGGG
GAGATACATTCTCAATTGAAGATATTCAAGAAACACCTATCACCAAATCAGGGCTCGATGCCTCCATTATACTTT
GTCAAGCTTGATATCCAATCTTGCTTTGACACAATCCCTCAACAGAGCCTGATCCATGTTATCGAAGGGCTGATC
ACCGAAGCAGCCTATCATTACACAAAACACGTTGAAATGACGCCGTCTGATGAATTCAACGTCCTGTGGCCATCG
CACGAAGCCCGGCCAAGCAAGGCTAGGCGGCGATTTGTCGGTAGGGCAGCGCCTGCTGCAAGGCCACAGCACCTG
GCAGAGGCGGTGACAAACGGCGAGACCAGCCAGAGGCGAAACACCGTCTTTGTCGACACCCTCATGCAGAGAGAA
TTCAATGCGGAAGATTTACTGGACCTCCTTGATGACCACGTGCGAAACAATCTCATCAAGTTCGGGCGGAATTAC
TTTCGGCAACGCAATGGCATTCCCCAGGGCTCAGTGTTATCGAGCATGTTGTGCAACCTTTTCTATGCAGACATG
GAGCAGCAAGTGCTGGGATTTCTGCAGTCAGACAAAGCTTTACTGGTTCGCCTAGTTGATGATTTTCTACTCGTC
ACTACCGACTCCTCATTGGCCATGCGTTTTCTCCAGGTCATGATCCCCGGGCAGCCTGCGTACGGGGTTTCGGTC
AATCCAGCTAAAAGCCTGGTCAACTTCGCCGCCGCTGTGGACGGGATTCAAATCCCGCGCCTCGTGGATACTCGG
CTCTTCCCTTACTGCGGAAGTCTGATCGATACTCGTTCTTTGGAGATCTACAAGGATCATGAGCGCATCCTGGAA
GGGGGCCAATCAGTCGCCACCAGTCTCTCGAACTCGCTCACCATCGAGGTGACGCGAGCACCGGGCCGGACTCTT
CACCGCAAACTGCTTGGGTCCTTCAAGCTGCTCATGCATCCCATGTACTTGGATAGGCAACACAACACGATCGGA
GTGATCCTATCGAACCTGTACGCGAACTTCGTCATATCGGCGATGAAGATGTACCGATACTTGAAGTCGCTGTCG
GGGCGGGTCCACCCAGCGCCCGTGGTGATTCGAATCGTTCGAGATGTGATACACCTAGCCACCCGCATGGTCCAA
GCCCGACGTGAGGCGAACTTACCACCAGCAGCTAGTCGTCGCGGGGTGCATCAGTGCGAGGTTGAATACTTGGCT
GCCGCGGCGTTCCGGTTTGTGCTGGGACGCAAGCAAGCCCGGTACGTGCGGGTGTTAGGCTGGCTGGATGTCATT
CTCAGAGAGAGCCAGCCCAATTCCAAGACACAGGCCTGGCAGCTAGGGCAGGTGGTGCGAACTGGCAATGCGACA
TATGGCGGCTGGAAGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail