Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g452.t1
Gene name
Locationscaffold_002:20652..22442
Strand-
Gene length (bp)1790
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 3.1E-136 64 524
PF13520 AA_permease_2 Amino acid permease 7.6E-32 67 501

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 94 116 22
3 136 158 22
4 173 195 22
5 202 224 22
6 255 277 22
7 297 319 22
8 345 367 22
9 394 413 19
10 423 445 22
11 472 494 22
12 499 516 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g452.t1
MAFGNKVKSTSAEGEKGKMAPEETVQVQPTNPSSDLNDIDCEKHGASRESNPMPDLKRKLRSRHLQMIAIGGTIG
TGLFIGSGTAVANGGPVGALIAYIFVGTIVYSVMTSLGEIATYIPIPGAFTAYAARLVDPSLGFAMGWIYWFSWA
STFALELTATGLIIQFWDDSINIAIFIAIFWVLIALLNFLPVSFYGELEFWLSSIKVITVVGFMIFAICIDAGVG
DKGYLGFRYWVDPGPFAPYSGVHPDSTAKFVGFWSVLIQAGFSYQGTELVGIAAAETENPRKTVPAAIRKTFYRI
LFFFVLTIFFIGLLVPYTNENLLTDGNDANSSPFVIAARLAGVKVLPHIINAVLLTVVLSAANSNVYSGSRILLG
LAQEGFAPRWFKKTSKKGVPYFSVAFTAAFGLLGFMNVSNAGSTVFNWLVNIAGVAGFITWASLNGCHLAFMRAL
KARDISRDTLPYKAIWQPYYSWYGLFFNILIIITQGFTSFITSFSVTDFFIDYISLILFVVLYVGHKIYFRTSFV
HPLEADIDTGRQEVENETWETEAPATKWHQKLARSFLG*
Coding >Ani_SJS100_1|g452.t1
ATGGCCTTCGGGAACAAGGTCAAATCCACGTCTGCCGAGGGGGAAAAGGGCAAGATGGCGCCTGAAGAGACTGTC
CAGGTTCAGCCCACGAACCCTTCGTCCGACTTGAACGACATCGATTGTGAGAAACATGGCGCCAGTCGCGAGTCA
AATCCCATGCCCGATCTCAAGCGGAAGCTGAGAAGTCGCCATCTTCAGATGATTGCCATTGGTGGTACTATTGGC
ACTGGTCTGTTCATCGGTAGTGGTACTGCTGTCGCCAACGGAGGTCCTGTTGGTGCCCTCATTGCCTACATCTTC
GTCGGTACGATCGTCTACTCGGTTATGACCTCCCTGGGTGAAATAGCGACCTATATTCCGATTCCTGGAGCGTTC
ACAGCCTACGCTGCTCGTCTGGTGGACCCCAGTCTTGGCTTCGCCATGGGGTGGATCTATTGGTTTTCCTGGGCT
AGTACATTTGCACTCGAGTTAACGGCAACCGGTCTGATCATTCAATTCTGGGACGACTCCATCAATATCGCTATC
TTCATCGCCATCTTTTGGGTTCTGATAGCTCTATTGAATTTCCTGCCTGTCAGCTTCTATGGTGAATTGGAATTC
TGGCTTTCAAGTATCAAAGTTATCACCGTTGTTGGGTTCATGATCTTCGCCATCTGCATTGACGCCGGCGTCGGT
GACAAAGGGTATCTCGGATTTCGCTATTGGGTCGACCCAGGCCCCTTTGCTCCTTATTCGGGTGTCCACCCCGAC
TCGACAGCAAAGTTCGTCGGTTTCTGGTCCGTTCTTATCCAGGCTGGCTTTTCGTATCAGGGAACGGAACTGGTC
GGTATCGCAGCCGCTGAGACAGAAAACCCTCGCAAAACGGTGCCTGCGGCTATTCGCAAGACCTTCTACCGCATT
CTGTTCTTCTTCGTCCTGACCATCTTCTTCATCGGTCTTCTGGTGCCCTACACCAACGAGAACCTCCTGACCGAT
GGAAACGATGCTAACTCGTCGCCTTTTGTCATTGCGGCTAGGCTTGCTGGAGTTAAGGTTCTGCCTCACATTATC
AACGCAGTCCTGCTGACTGTGGTGCTCTCTGCTGCCAATTCAAATGTTTACAGTGGCAGTCGTATCTTGCTTGGT
CTGGCTCAAGAAGGGTTTGCCCCGCGCTGGTTCAAGAAGACTTCTAAGAAGGGTGTGCCATACTTCAGCGTTGCC
TTCACGGCAGCCTTCGGTCTTCTCGGTTTCATGAATGTCTCCAATGCAGGTAGCACTGTGTTCAACTGGCTCGTC
AACATCGCCGGTGTCGCAGGCTTCATCACTTGGGCATCGTTGAACGGCTGCCATCTTGCTTTCATGCGTGCCCTG
AAGGCTCGCGACATCTCCCGTGACACCCTTCCTTATAAAGCTATCTGGCAGCCCTACTATTCCTGGTACGGGTTG
TTCTTCAACATCCTCATTATCATCACGCAAGGTTTCACCTCCTTTATTACCAGCTTCAGCGTCACGGATTTCTTC
ATTGATTACATCAGTCTGATTCTCTTCGTCGTGCTCTATGTTGGCCACAAGATCTACTTCCGGACATCTTTTGTC
CATCCTCTTGAGGCTGATATTGATACGGGCCGCCAGGAGGTCGAGAACGAAACGTGGGAAACGGAGGCTCCCGCC
ACGAAATGGCACCAGAAGCTTGCACGCTCATTCCTGGGCTGA
Transcript >Ani_SJS100_1|g452.t1
ATGGCCTTCGGGAACAAGGTCAAATCCACGTCTGCCGAGGGGGAAAAGGGCAAGATGGCGCCTGAAGAGACTGTC
CAGGTTCAGCCCACGAACCCTTCGTCCGACTTGAACGACATCGATTGTGAGAAACATGGCGCCAGTCGCGAGTCA
AATCCCATGCCCGATCTCAAGCGGAAGCTGAGAAGTCGCCATCTTCAGATGATTGCCATTGGTGGTACTATTGGC
ACTGGTCTGTTCATCGGTAGTGGTACTGCTGTCGCCAACGGAGGTCCTGTTGGTGCCCTCATTGCCTACATCTTC
GTCGGTACGATCGTCTACTCGGTTATGACCTCCCTGGGTGAAATAGCGACCTATATTCCGATTCCTGGAGCGTTC
ACAGCCTACGCTGCTCGTCTGGTGGACCCCAGTCTTGGCTTCGCCATGGGGTGGATCTATTGGTTTTCCTGGGCT
AGTACATTTGCACTCGAGTTAACGGCAACCGGTCTGATCATTCAATTCTGGGACGACTCCATCAATATCGCTATC
TTCATCGCCATCTTTTGGGTTCTGATAGCTCTATTGAATTTCCTGCCTGTCAGCTTCTATGGTGAATTGGAATTC
TGGCTTTCAAGTATCAAAGTTATCACCGTTGTTGGGTTCATGATCTTCGCCATCTGCATTGACGCCGGCGTCGGT
GACAAAGGGTATCTCGGATTTCGCTATTGGGTCGACCCAGGCCCCTTTGCTCCTTATTCGGGTGTCCACCCCGAC
TCGACAGCAAAGTTCGTCGGTTTCTGGTCCGTTCTTATCCAGGCTGGCTTTTCGTATCAGGGAACGGAACTGGTC
GGTATCGCAGCCGCTGAGACAGAAAACCCTCGCAAAACGGTGCCTGCGGCTATTCGCAAGACCTTCTACCGCATT
CTGTTCTTCTTCGTCCTGACCATCTTCTTCATCGGTCTTCTGGTGCCCTACACCAACGAGAACCTCCTGACCGAT
GGAAACGATGCTAACTCGTCGCCTTTTGTCATTGCGGCTAGGCTTGCTGGAGTTAAGGTTCTGCCTCACATTATC
AACGCAGTCCTGCTGACTGTGGTGCTCTCTGCTGCCAATTCAAATGTTTACAGTGGCAGTCGTATCTTGCTTGGT
CTGGCTCAAGAAGGGTTTGCCCCGCGCTGGTTCAAGAAGACTTCTAAGAAGGGTGTGCCATACTTCAGCGTTGCC
TTCACGGCAGCCTTCGGTCTTCTCGGTTTCATGAATGTCTCCAATGCAGGTAGCACTGTGTTCAACTGGCTCGTC
AACATCGCCGGTGTCGCAGGCTTCATCACTTGGGCATCGTTGAACGGCTGCCATCTTGCTTTCATGCGTGCCCTG
AAGGCTCGCGACATCTCCCGTGACACCCTTCCTTATAAAGCTATCTGGCAGCCCTACTATTCCTGGTACGGGTTG
TTCTTCAACATCCTCATTATCATCACGCAAGGTTTCACCTCCTTTATTACCAGCTTCAGCGTCACGGATTTCTTC
ATTGATTACATCAGTCTGATTCTCTTCGTCGTGCTCTATGTTGGCCACAAGATCTACTTCCGGACATCTTTTGTC
CATCCTCTTGAGGCTGATATTGATACGGGCCGCCAGGAGGTCGAGAACGAAACGTGGGAAACGGAGGCTCCCGCC
ACGAAATGGCACCAGAAGCTTGCACGCTCATTCCTGGGCTGA
Gene >Ani_SJS100_1|g452.t1
ATGGCCTTCGGGAACAAGGTCAAATCCACGTCTGCCGAGGGGGAAAAGGGCAAGATGGCGCCTGAAGAGACTGTC
CAGGTTCAGCCCACGAACCCTTCGTCCGACTTGAACGACATCGATTGTGAGAAACATGGCGCCAGTCGCGAGTCA
AATCCCATGCCCGATCTCAAGCGGAAGCTGAGAAGTCGCCATCTTCAGATGATTGCCATTGGTGAGTCCTGCTGG
CTGTCTTGAGTTCTTTCCCTTTCTTCTTCTGCCGTAAGACAGGCGGCCATTCCGCAAGTGACAACCTGCTCATTC
AATTCATAGGTGGTACTATTGGCACTGGTCTGTTCATCGGTAGTGGTACTGCTGTCGCCAACGGAGGTCCTGTTG
GTGCCCTCATTGCCTACATCTTCGTCGGTACGATCGTCTACTCGGTTATGACCTCCCTGGGTGAAATAGCGACCT
ATATTCCGATTCCTGGAGCGTTCACAGCCTACGCTGCTCGTCTGGTGGACCCCAGTCTTGGCTTCGCCATGGGGT
GGATCTATTGGTTTTCCTGGGCTAGTACATTTGCACTCGAGTTAACGGCAACCGGTCTGATCATTCAATTCTGGG
ACGACTCCATCAATATCGCTATCTTCATCGCCATCTTTTGGGTTCTGATAGCTCTATTGAATTTCCTGCCTGTCA
GCTTCTATGGTGAATTGGAATTCTGGCTTTCAAGTATCAAAGTTATCACCGTTGTTGGGTTCATGATCTTCGCCA
TCTGCATTGACGCCGGCGTCGGTGACAAAGGGTATCTCGGATTTCGCTATTGGGTCGACCCAGGCCCCTTTGCTC
CTTATTCGGGTGTCCACCCCGACTCGACAGCAAAGTTCGTCGGTTTCTGGTCCGTTCTTATCCAGGCTGGCTTTT
CGTATCAGGGAACGGAACTGGTCGGTATCGCAGCCGCTGAGACAGAAAACCCTCGCAAAACGGTGCCTGCGGCTA
TTCGCAAGACCTTCTACCGCATTCTGTTCTTCTTCGTCCTGACCATCTTCTTCATCGGTCTTCTGGTGCCCTACA
CCAACGAGAACCTCCTGACCGATGGAAACGATGCTAACTCGTCGCCTTTTGTCATTGCGGCTAGGCTTGCTGGAG
TTAAGGTTCTGCCTCACATTATCAACGCAGTCCTGCTGACTGTGGTGCTCTCTGCTGCCAATTCAAATGTTTACA
GTGGCAGTCGTATCTTGCTTGGTCTGGCTCAAGAAGGGTTTGCCCCGCGCTGGTTCAAGAAGACTTCTAAGAAGG
GTGTGCCATACTTCAGCGTTGCCTTCACGGCAGCCTTCGGTCTTCTCGGTTTCATGAATGTCTCCAATGCAGGTA
GCACTGTGTTCAACTGGCTCGTCAACATCGCCGGTGTCGCAGGCTTCATCACTTGGGCATCGTTGAACGGCTGCC
ATCTTGCTTTCATGCGTGCCCTGAAGGCTCGCGACATCTCCCGTGACACCCTTCCTTATAAAGCTATCTGGCAGC
CCTACTATTCCTGGTACGGGTTGTTCTTCAACATCCTCATTATCATCACGCAAGGTTTCACCTCCTTTATTACCA
GCTTCAGCGTCACGGATTTCTTCATTGATTACATCAGTCTGATTCTCTTCGTCGTGCTCTATGTTGGCCACAAGA
TCTACTTCCGGACATCTTTTGTCCATCCTCTTGAGGCTGATATTGATACGGGCCGCCAGGAGGTCGAGAACGAAA
CGTGGGAAACGGAGGCTCCCGCCACGAAATGGCACCAGAAGCTTGCACGCTCATTCCTGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail