Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4447.t1
Gene name
Locationscaffold_022:296570..297614
Strand+
Gene length (bp)1044
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10369 ALS_ss_C Small subunit of acetolactate synthase 1.0E-13 237 297
PF01842 ACT ACT domain 1.4E-12 93 157
PF13710 ACT_5 ACT domain 9.3E-08 102 160

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4447.t1
MAFRRPLMLSTTASTPFLSVASRTSRLGASRFSTTIRASSSSSTSALAYKALHRRSPLPLPVNDASPQWDAPTAV
SSILYETPSVPTNPPKRHILNCLVQNEPGVLSRVSGILAARGFNIDSLVVCNTEVEDLSRMTIVLQGQDGVVEQA
RRQLDDLVPVWAVLDYTDSALVQRELLLAKVSILGPEFFEELLQHHREITTPGEQTEGQKDKAAQVAKTEFHPRN
LPHSQALRHKHEHLDAITRLTHQFGGKVLDISTNNCIVEVSAKPSRIDSFMKLIGPFGVLESTRTGLMALPRSPL
FEPSEEIEKDAADVVDASTLPPG*
Coding >Ani_SJS100_1|g4447.t1
ATGGCATTCCGGCGTCCTTTGATGCTGTCAACGACAGCATCAACGCCTTTCCTGTCCGTTGCGAGCCGCACCTCA
CGCCTGGGAGCCTCCCGATTCAGCACCACCATTCGGGCCTCTTCCTCCAGCTCGACCTCAGCCCTAGCCTACAAG
GCCCTTCATCGCCGGTCTCCCCTCCCTCTCCCCGTCAACGATGCCTCGCCGCAATGGGACGCCCCCACGGCCGTT
TCGTCCATTCTCTACGAAACCCCTTCCGTCCCCACCAACCCTCCCAAGCGCCATATCCTGAACTGTCTGGTGCAG
AACGAGCCCGGTGTGTTGTCCCGCGTGTCCGGTATCCTGGCTGCTCGCGGCTTCAACATCGACTCTCTCGTCGTC
TGCAACACCGAGGTCGAGGATCTGTCTCGTATGACCATCGTCTTGCAGGGTCAGGACGGCGTCGTCGAGCAGGCT
CGTCGTCAACTCGATGATCTCGTCCCCGTCTGGGCCGTCCTCGATTACACTGACTCCGCCCTGGTGCAGCGCGAA
CTCCTCCTCGCCAAGGTCAGCATCTTGGGCCCCGAGTTCTTCGAGGAGTTGCTGCAGCACCACCGCGAAATCACC
ACCCCCGGTGAGCAGACTGAGGGTCAGAAGGATAAGGCTGCGCAGGTTGCGAAGACCGAGTTCCACCCTCGTAAT
CTGCCCCATTCTCAGGCTTTGAGACACAAGCATGAGCATTTGGATGCGATTACTCGCTTGACTCATCAGTTCGGT
GGAAAGGTGCTGGATATCAGTACCAACAACTGCATTGTTGAGGTCTCCGCCAAACCCTCCCGTATCGACTCCTTC
ATGAAGCTCATCGGCCCCTTCGGTGTCCTCGAGTCCACCCGTACCGGTCTGATGGCTCTGCCCCGGTCTCCTCTC
TTCGAGCCTAGCGAGGAGATCGAGAAGGACGCCGCTGACGTTGTTGACGCCAGCACCCTTCCTCCCGGTTAA
Transcript >Ani_SJS100_1|g4447.t1
ATGGCATTCCGGCGTCCTTTGATGCTGTCAACGACAGCATCAACGCCTTTCCTGTCCGTTGCGAGCCGCACCTCA
CGCCTGGGAGCCTCCCGATTCAGCACCACCATTCGGGCCTCTTCCTCCAGCTCGACCTCAGCCCTAGCCTACAAG
GCCCTTCATCGCCGGTCTCCCCTCCCTCTCCCCGTCAACGATGCCTCGCCGCAATGGGACGCCCCCACGGCCGTT
TCGTCCATTCTCTACGAAACCCCTTCCGTCCCCACCAACCCTCCCAAGCGCCATATCCTGAACTGTCTGGTGCAG
AACGAGCCCGGTGTGTTGTCCCGCGTGTCCGGTATCCTGGCTGCTCGCGGCTTCAACATCGACTCTCTCGTCGTC
TGCAACACCGAGGTCGAGGATCTGTCTCGTATGACCATCGTCTTGCAGGGTCAGGACGGCGTCGTCGAGCAGGCT
CGTCGTCAACTCGATGATCTCGTCCCCGTCTGGGCCGTCCTCGATTACACTGACTCCGCCCTGGTGCAGCGCGAA
CTCCTCCTCGCCAAGGTCAGCATCTTGGGCCCCGAGTTCTTCGAGGAGTTGCTGCAGCACCACCGCGAAATCACC
ACCCCCGGTGAGCAGACTGAGGGTCAGAAGGATAAGGCTGCGCAGGTTGCGAAGACCGAGTTCCACCCTCGTAAT
CTGCCCCATTCTCAGGCTTTGAGACACAAGCATGAGCATTTGGATGCGATTACTCGCTTGACTCATCAGTTCGGT
GGAAAGGTGCTGGATATCAGTACCAACAACTGCATTGTTGAGGTCTCCGCCAAACCCTCCCGTATCGACTCCTTC
ATGAAGCTCATCGGCCCCTTCGGTGTCCTCGAGTCCACCCGTACCGGTCTGATGGCTCTGCCCCGGTCTCCTCTC
TTCGAGCCTAGCGAGGAGATCGAGAAGGACGCCGCTGACGTTGTTGACGCCAGCACCCTTCCTCCCGGTTAA
Gene >Ani_SJS100_1|g4447.t1
ATGGCATTCCGGCGTCCTTTGATGCTGTCAACGACAGCATCAACGCCTTTCCTGTCCGTTGCGAGCCGCACCTCA
CGCCTGGGAGCCTCCCGATTCAGCACCACCATTCGGGCCTCTTCCTCCAGCTCGACCTCAGCCCTAGCCTACAAG
GCCCTTCATCGCCGGTCTCCCCTCCCTCTCCCCGTCAACGATGCCTCGCCGCAATGGGACGCCCCCACGGCCGTT
TCGTCCATTCTCTACGAAACCCCTTCCGTCCCCACCAACCCTCCCAAGCGCCATATCCTGAACTGTCTGGTGCAG
AACGAGCCCGGTGTGTTGTCCCGCGTGTCCGGTATCCTGGCTGCTCGCGGCTTCAACATCGACTCTCTCGTCGTC
TGCAACACCGAGGTCGAGGATCTGTCTCGTATGACCATCGTCTTGCAGGGTCAGGACGGCGTCGTCGAGCAGGCT
CGTCGTCAACTCGATGATCTCGTCCCCGTCTGGGCCGTCCTCGATTACACTGACTCCGCCCTGGTGCAGCGCGAA
CTCCTCCTCGCCAAGGTCAGCATCTTGGGCCCCGAGTTCTTCGAGGAGTTGCTGCAGCACCACCGCGAAATCACC
ACCCCCGGTGAGCAGACTGAGGGTCAGAAGGATAAGGCTGCGCAGGTTGCGAAGACCGAGTTCCACCCTCGTAAT
CTGCCCCATTCTCAGGCTTTGAGACACAAGCATGAGCATTTGGATGCGATTACTCGCTTGACTCATCAGTTCGGT
GGAAAGGTGCTGGATATCAGTACCAACAACTGCATTGTTGAGGTGTAAGTTTCCTCCCTAACCAGCATGAGTCAT
ACGATTCTGGTTTTTCTTGGTGCTAATGATATGTGATATAGCTCCGCCAAACCCTCCCGTATCGACTCCTTCATG
AAGCTCATCGGCCCCTTCGGTGTCCTCGAGTCCACCCGTACCGGTCTGATGGCTCTGCCCCGGTCTCCTCTCTTC
GAGCCTAGCGAGGAGATCGAGAAGGACGCCGCTGACGTTGTTGACGCCAGCACCCTTCCTCCCGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail