Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4402.t1
Gene name
Locationscaffold_022:163351..165536
Strand-
Gene length (bp)2185
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07281 INSIG Insulin-induced protein (INSIG) 5.8E-63 124 314

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 117 139 22
2 160 182 22
3 235 254 19
4 261 278 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4402.t1
MSDEPTILRPRPRRVFDLTPEEPSTPVEPANPDLLVPKDAGSTSVSRNASIMNLTSSTLYGIYSPTAFDSSRDDS
SPWGTEAHTPQSGSPRIQSEAPAPGKLRRTRSRLSHGLFRGVILPQALKSAFLLGFGVVYGVITIHLHENHWITP
VKLENTHYYGSWQYLAFWGVAGAVLGNILPWFDQFSDEIIGSPKQAKGSSDPETADRTLSWVSVVRSVGAFVGIA
FAMRRLPWESTTQASLTLALVNPVLWYLIDRTRTGFVLSTVVGLAGMGIILGLKPDLIPSAETSAFAASKFDVTG
WGYGLAVEMSQESIADLGHPPVAKVKLYYLCHCSTNGLDGNITNLEAIIFPQFPPIFQ*
Coding >Ani_SJS100_1|g4402.t1
ATGTCTGACGAGCCTACGATCCTTCGCCCGCGTCCGCGACGTGTGTTCGATCTCACGCCTGAAGAGCCCTCTACC
CCAGTCGAACCCGCCAACCCAGACCTGCTCGTCCCTAAAGATGCCGGCTCTACCAGCGTCAGCCGCAATGCTTCG
ATCATGAACTTGACCTCGTCGACGCTGTACGGTATTTACTCTCCTACTGCATTCGACAGTTCTCGTGACGACTCG
AGTCCCTGGGGCACGGAAGCCCATACGCCTCAGTCAGGAAGCCCGAGGATCCAGTCTGAAGCTCCAGCACCAGGC
AAACTTCGGCGGACACGATCACGGCTTAGCCACGGCCTGTTTCGAGGCGTCATCCTTCCGCAAGCGCTGAAGAGC
GCTTTCCTCTTGGGCTTTGGTGTTGTTTATGGAGTCATTACAATTCACCTGCATGAAAACCATTGGATTACCCCG
GTGAAGTTGGAGAATACACATTACTACGGATCATGGCAGTATCTTGCTTTCTGGGGTGTGGCCGGCGCCGTTTTG
GGCAATATTCTTCCTTGGTTCGACCAGTTCTCAGATGAAATTATTGGCAGCCCTAAGCAGGCAAAAGGGTCAAGC
GACCCCGAGACTGCAGACCGTACTCTCTCATGGGTTTCAGTGGTTCGCAGCGTTGGCGCGTTTGTGGGAATTGCA
TTTGCCATGCGCCGACTTCCCTGGGAATCTACAACTCAAGCGTCACTTACCCTCGCGCTCGTGAACCCCGTACTC
TGGTACCTCATCGACCGCACACGGACCGGCTTCGTCTTATCGACCGTTGTTGGATTGGCCGGCATGGGAATAATA
TTGGGACTCAAGCCTGACTTAATTCCGTCTGCAGAGACTTCGGCTTTTGCAGCAAGCAAATTCGATGTCACCGGT
TGGGGATATGGGCTGGCTGTTGAGATGTCACAGGAAAGCATAGCAGATCTTGGTCACCCGCCAGTCGCGAAGGTA
AAGTTATATTATCTCTGCCATTGTTCTACCAACGGTCTGGACGGTAATATAACAAATCTGGAGGCCATTATATTC
CCTCAATTTCCTCCAATTTTCCAGTGA
Transcript >Ani_SJS100_1|g4402.t1
ATGTCTGACGAGCCTACGATCCTTCGCCCGCGTCCGCGACGTGTGTTCGATCTCACGCCTGAAGAGCCCTCTACC
CCAGTCGAACCCGCCAACCCAGACCTGCTCGTCCCTAAAGATGCCGGCTCTACCAGCGTCAGCCGCAATGCTTCG
ATCATGAACTTGACCTCGTCGACGCTGTACGGTATTTACTCTCCTACTGCATTCGACAGTTCTCGTGACGACTCG
AGTCCCTGGGGCACGGAAGCCCATACGCCTCAGTCAGGAAGCCCGAGGATCCAGTCTGAAGCTCCAGCACCAGGC
AAACTTCGGCGGACACGATCACGGCTTAGCCACGGCCTGTTTCGAGGCGTCATCCTTCCGCAAGCGCTGAAGAGC
GCTTTCCTCTTGGGCTTTGGTGTTGTTTATGGAGTCATTACAATTCACCTGCATGAAAACCATTGGATTACCCCG
GTGAAGTTGGAGAATACACATTACTACGGATCATGGCAGTATCTTGCTTTCTGGGGTGTGGCCGGCGCCGTTTTG
GGCAATATTCTTCCTTGGTTCGACCAGTTCTCAGATGAAATTATTGGCAGCCCTAAGCAGGCAAAAGGGTCAAGC
GACCCCGAGACTGCAGACCGTACTCTCTCATGGGTTTCAGTGGTTCGCAGCGTTGGCGCGTTTGTGGGAATTGCA
TTTGCCATGCGCCGACTTCCCTGGGAATCTACAACTCAAGCGTCACTTACCCTCGCGCTCGTGAACCCCGTACTC
TGGTACCTCATCGACCGCACACGGACCGGCTTCGTCTTATCGACCGTTGTTGGATTGGCCGGCATGGGAATAATA
TTGGGACTCAAGCCTGACTTAATTCCGTCTGCAGAGACTTCGGCTTTTGCAGCAAGCAAATTCGATGTCACCGGT
TGGGGATATGGGCTGGCTGTTGAGATGTCACAGGAAAGCATAGCAGATCTTGGTCACCCGCCAGTCGCGAAGGTA
AAGTTATATTATCTCTGCCATTGTTCTACCAACGGTCTGGACGGTAATATAACAAATCTGGAGGCCATTATATTC
CCTCAATTTCCTCCAATTTTCCAGTGA
Gene >Ani_SJS100_1|g4402.t1
ATGTCTGACGAGCCTACGATCCTTCGCCCGCGTCCGCGACGTGTGTTCGATCTCACGCCTGAAGAGCCCTCTACC
CCAGTCGAACCCGCCAACCCAGACCTGCTCGTCCCTAAAGATGCCGGCTCTACCAGCGTCAGCCGCAATGCTTCG
ATCATGAACTTGACCTCGTCGACGCTGTACGGTATTTACTCTCCTACTGCATTCGACAGTTCTCGTGACGACTCG
AGTCCCTGGGGCACGGAAGCCCATACGCCTCAGTCAGGAAGCCCGAGGATCCAGTCTGAAGCTCCAGCACCAGGC
AAACTTCGGCGGACACGATCACGGCTTAGCCACGGCCTGTTTCGAGGCGTCATCCTTCCGCAAGCGCTGAAGAGC
GCTTTCCTCTTGGGCTTTGGTGTTGTTTATGGAGTCATTACAATTCACCTGCATGAAAACCATTGGATTACCCCG
GTGAAGTTGGAGAATACACATTACTACGGATCATGGCAGTATCTTGCTTTCTGGGGTGTGGCCGGCGCCGTTTTG
GGCAATATTCTTCCTTGGTTCGACCAGTTCTCAGATGAAATTATTGGCAGCCCTAAGCAGGCAAAAGGGTCAAGC
GACCCCGAGACTGCAGACCGTACTCTCTCATGGGTTTCAGTGGTTCGCAGCGTTGGCGCGTTTGTGGGAATTGCA
TTTGCCATGGTAAGCAAAATTCTAGCAACCAGCGTTCGTCGGTTCGATACTAATCTGGCTTTGTATCTTACAGCG
CCGACTTCCCTGGGAATCTACAACTCAAGCGTCACTTACCCTCGCGCTCGTGAACCCCGTACTCTGGTACCTCAT
CGACCGCACACGGACCGGCTTCGTCTTATCGACCGTTGTTGGATTGGCCGGCATGGGAATAATATTGGGACTCAA
GCCTGACTTAATTCCGTCTGCAGAGACTTCGGCTTTTGCAGCAAGCAAATTCGATGTCACCGGTTGGGGATATGG
GCTGGCTGTTGAGATGTCACAGGAAAGCATAGCAGTAAGGACTTGGGTTGCCAGCGTTCTTTTCTGCGCATGTGT
ATGCTTTGGAAACATTGGCCGGCAGCTTGCCATTGGAGTCCAGCGCGAGTCGCTCAAGTGAAGCGAGGACAGGAT
CGTACCCTTCTCATCCCATCACTCAATTAACACAGGGCATTTTGTATACCCTAGCACTCCACTTTTTATAATGCA
GAAACCCTCCTTCCTTTGGCCTTGTGCAGTTTCTCAGAGACAAGTCTGTTACTAGATAGATGATCCGTTAAGCCA
GAAGCCATGGCGACGAGATTATGGAAATGACTACGAACTCCGAATACACGAAGTGACAATAAATATTAGTTAGAT
AGTTAGGCAGAGATTGTAGAATCAATCATTGCAGTCCCTTCCACCGAACCTAAGTTCAAGTCAGACACTGCACCC
AAGATCGATACTCTGCCAGAGGCAGTTTCTCTCCATTCTGTATGACGATTTCCGTACTTCATCGGCTATACAGAC
CCAGTAGGGAAAGATATCCTCGCAGGAACGCTTTTTGAAGAATGTTGATTTTGCGTTGTTCATGTGGAAGAAAAG
AAAAAAGAAAATCAAAGCGAAGCGGCCGAGCGAAACTTTTGTAGTGGAATGTTTGTGGCCTGTGCGCGGGTCATG
TGACGGCACGTGATTAGTTTTATTCTCGAGATAACAGCTGACTAATTATAGCATGCATAAATAGCCGATGATAAA
ACTAAGCCGAAAAGGGCAAGCACCTGTGGCGTCCCTCCCACGGGTTTGAAGCTAACTACGACAGATGGCGGTTAG
TAATCGATAGGATCTTGGTCACCCGCCAGGTCCGAAAGCGGCGAAGGACCCCGCGGCGGGACATCGAGGAGAAAT
TGAGGGAACTTCAATCGAGGCTGCCTTGGATCAGTCGCGAAGGTAAAGTTATATTATCTCTGCCATTGTTCTACC
AACGGTCTGGACGGTAATATAACAAATCTGGAGGCCATTATATTCCCTCAATTTCCTCCAATTTTCCAGGTACGT
ATCCTACGAGGTCATCGCAATGTTCTTGATGTTGCTCTTGCTCTGTGTGCGGAGCTCCCAGTTGATCGTCCCGGA
GGGGCTGTGGGGGGCCCTTTTTATTCGACCTGAACAATTTTTCCCTCTTCATCATTCCTGACTCTGTGCTTCTCT
GCTCTAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail