Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4277.t1
Gene name
Locationscaffold_021:224846..229793
Strand-
Gene length (bp)4947
Transcript length (bp)4047
Coding sequence length (bp)4047
Protein length (aa) 1349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-07 744 821
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.5E-07 842 916
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.3E-08 896 965
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.8E-12 940 1032
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-10 1044 1134
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.8E-13 1120 1203
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.6E-11 1199 1272
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-08 938 989
PF13637 Ank_4 Ankyrin repeats (many copies) 7.2E-07 1141 1193
PF13637 Ank_4 Ankyrin repeats (many copies) 4.8E-08 1175 1225
PF13637 Ank_4 Ankyrin repeats (many copies) 2.0E-05 1243 1300
PF00023 Ank Ankyrin repeat 3.3E-03 1139 1170
PF00023 Ank Ankyrin repeat 2.3E-03 1241 1272
PF05729 NACHT NACHT domain 3.4E-08 293 439

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4277.t1
MTTALTKAARLKPEVRLGQAISEFQADCSSLEKATLRSFQAAGIPPGIRDVMQLTAEINRSAGLQGRCFGSRLTN
ILQAVQEFAALGDIVLGASQSLLACGIWALVRMSLLSIVKYSAYFEQLSAMLMAVGRSAPRYQLMGAVYPKSQRL
RTSMLEYFITVVQLCHHVIKLSRKTAFGQWASTMTTPLKGYQSDLELWAAAIKEEVNLLMVQQLSLEAEDNSWFR
SQVTKRFESQSYARKLKARQRVLDACSTYDYEQDWKRIRKLGTTTMLETSAVYANWKAQQSPQGLQSRTLVCSGK
LGSGKSVILANMVDDLNLDVGRKPVVAYFFCQHDSTQSLAPKTVIGSLARQLLQSENDFDVARDFLGDKRSLEVD
EILSLLKHLLPTQFEAVFILDGLMHCDAEARQVILTSLQEIQNLIKLSLCVSVRPEPADSLQELKQLSNQQFLPV
EDNKPDIDAFINAELERCLESGKLVINDPALILEIRDSLSQGAQGMFLWAALQIEALCLERTDADMREAIASLPR
DLSALYTMILKKSRLSDVTYQSKILDLVAIACRPLTTEEMREALSVVPWETTWDPARRLNDIHATLGCCGSLLTV
DEESSSIRVVHHSVKKFIFDHTGGGLNVNRANQTMAGIIVTYLNYEVFSRQLSTVKVPKISSSSVTAAVVNSTVP
ARRQSQSFALKLLRLKKSKDTDVGYSLLQYLQASRASDTVPWALYQYSVAWWQEHIWYLDLDLPNLHKLLINLLE
VHDYDKPDFNGRTPLSHASQSGSLALVNWLLARGARHTADLAGQSPLSWAINGRHLAVIDTLLKSEAVDPSVIDW
SGETPLISVIMMRDLEALNCFCDCGARIDWNQTGSNGYTPLMTATLINFVEAILALLKRLGPHILTQSPIGDTAL
HLAARKGYAEAFKFILVQAMVKQSFSKPLLITNGNGETPLWLAAAHGHLEVVQSILQYQDFDLDVPDTGGETPFW
VAASNGHTEIVRCLANSGRVNVNHLNKAGLSALWAAVFNGHEDVVQAMIIMKSLDPNHSESGAGAPLEAAIRLGK
ERMVRLLVGNARTEVDQQIQHGKTPLQLAAEEGYEEILAILVSTRRVIHNRRGYQGVTPLWSAADCGHSGVVRVL
ANTEGVDLNFPRMYGSTALWAAASNGHVEVVQILISTGQVDLNSKGQSGTTPLWAAADNGHTEVVNVLASTDGVD
MDCPDDKGITPLWSAASNGYYHIVQSLVNTGRVAINSVAANGTTPLWAAAENGHDDVVRTLIDVGVNLNCTDIVS
HSRAKQTPLWIASCNGHTGVVEMLVACPGVELDRRDEEGYTPLGIAAKMGHASVVAILRTTPDQSAKSDARRQ*
Coding >Ani_SJS100_1|g4277.t1
ATGACGACCGCTCTCACCAAAGCCGCGAGACTGAAACCTGAAGTCCGGTTGGGACAGGCCATCTCCGAGTTCCAA
GCGGACTGCTCCTCGCTGGAGAAGGCAACGCTGCGATCATTCCAGGCTGCTGGAATCCCGCCAGGTATCCGTGAT
GTGATGCAGTTGACTGCAGAGATCAACCGATCGGCTGGCCTCCAAGGACGATGTTTCGGATCACGGCTAACCAAC
ATTCTCCAGGCGGTGCAGGAGTTCGCTGCGCTTGGAGACATTGTCCTGGGCGCTTCGCAGAGCCTCCTAGCCTGT
GGCATCTGGGCATTGGTACGAATGTCACTTCTGTCCATCGTCAAGTACTCGGCCTACTTTGAACAGCTATCGGCC
ATGCTCATGGCCGTGGGCCGCTCTGCACCTCGTTATCAACTAATGGGCGCCGTCTATCCAAAGTCACAGCGTCTC
CGAACATCAATGCTGGAATACTTCATCACCGTTGTGCAGCTATGTCATCATGTCATAAAGTTGAGTCGGAAGACA
GCCTTCGGCCAGTGGGCTTCGACTATGACAACTCCCCTGAAAGGCTACCAATCTGACCTTGAGCTCTGGGCGGCC
GCCATCAAAGAAGAAGTGAATCTGCTTATGGTTCAGCAATTATCTCTGGAAGCCGAGGATAATTCATGGTTCAGG
TCTCAAGTCACTAAACGCTTTGAATCCCAATCGTACGCAAGAAAACTGAAAGCGCGCCAGCGCGTACTTGATGCT
TGTTCTACGTATGACTATGAACAAGACTGGAAGCGGATCCGCAAGCTCGGGACTACCACTATGCTGGAGACCTCG
GCTGTGTACGCGAATTGGAAAGCTCAACAATCTCCACAAGGGCTACAATCGCGTACACTCGTGTGTTCAGGCAAG
CTAGGATCGGGAAAGTCCGTCATTCTCGCAAATATGGTGGATGACCTCAACTTGGACGTGGGAAGGAAGCCAGTA
GTGGCGTACTTCTTCTGCCAACATGACTCGACGCAAAGCCTGGCCCCGAAAACAGTAATAGGGTCCTTAGCGCGA
CAACTGTTGCAATCGGAAAATGACTTCGATGTTGCGCGTGATTTCTTGGGAGACAAGCGTTCTCTCGAGGTTGAC
GAGATTCTAAGTTTACTAAAGCATCTACTGCCGACGCAGTTCGAGGCCGTTTTCATTCTTGACGGATTGATGCAC
TGCGATGCGGAAGCGCGACAAGTCATCTTGACATCTTTACAGGAGATCCAGAACCTGATCAAGCTGTCATTGTGC
GTTTCTGTCAGGCCAGAGCCCGCCGACTCTCTGCAGGAACTAAAACAGCTCTCGAACCAGCAGTTTCTTCCCGTT
GAGGATAATAAACCCGACATTGATGCTTTCATCAACGCCGAATTAGAGAGATGTCTCGAATCCGGAAAGCTTGTA
ATAAACGACCCCGCCCTTATTCTTGAGATTCGGGATAGTCTCTCTCAAGGAGCCCAGGGAATGTTCCTGTGGGCG
GCTCTGCAGATAGAAGCCCTGTGTCTTGAGAGAACAGACGCAGATATGCGAGAGGCAATTGCCAGTTTACCTAGA
GATCTCTCAGCCTTATACACTATGATACTAAAAAAATCTAGACTCTCCGACGTCACATATCAATCCAAAATTCTG
GATCTGGTTGCGATCGCGTGCAGGCCACTGACCACAGAGGAAATGAGAGAAGCCCTCAGTGTCGTTCCCTGGGAG
ACGACCTGGGACCCCGCGAGGAGATTGAATGACATCCATGCAACATTGGGCTGCTGTGGGAGTCTGCTTACTGTA
GACGAAGAAAGCTCGAGCATTCGAGTGGTGCATCATAGTGTGAAAAAATTTATATTCGACCACACCGGAGGAGGG
CTTAATGTGAATCGCGCAAATCAAACCATGGCAGGGATCATCGTCACCTACCTGAATTATGAAGTGTTCTCCAGG
CAGTTGTCGACAGTCAAGGTACCTAAAATCAGCTCCAGCTCAGTCACAGCGGCGGTGGTCAACTCGACCGTTCCC
GCTCGTCGCCAATCCCAAAGCTTTGCATTGAAGCTGTTGAGACTGAAGAAGAGCAAGGATACGGACGTTGGCTAC
AGTCTCTTGCAATACCTGCAAGCCTCCAGAGCAAGTGACACCGTGCCCTGGGCCCTTTACCAATATTCAGTGGCA
TGGTGGCAGGAGCATATTTGGTATCTTGACCTCGATTTGCCTAACCTACACAAGCTCCTGATCAATTTATTGGAG
GTTCATGACTATGACAAACCGGACTTCAATGGCCGGACGCCGTTGTCACATGCCTCTCAGAGCGGGAGTCTGGCT
CTCGTTAACTGGCTCCTCGCTCGTGGTGCTCGCCATACCGCCGACCTTGCAGGACAATCACCGCTATCTTGGGCC
ATCAATGGGAGACATCTGGCTGTGATCGACACCCTCTTGAAGAGTGAAGCCGTGGATCCGAGTGTAATAGATTGG
TCAGGGGAAACGCCTCTCATCTCTGTCATAATGATGAGAGATCTCGAGGCACTCAATTGCTTCTGTGATTGTGGG
GCTCGGATTGATTGGAACCAAACAGGTTCCAACGGATATACGCCTCTTATGACCGCTACGCTTATCAACTTTGTG
GAAGCAATACTGGCGCTCTTAAAACGCTTGGGGCCACATATCCTCACCCAGTCTCCAATTGGAGACACGGCCCTT
CATCTCGCTGCCCGTAAGGGCTACGCGGAGGCTTTCAAATTCATCCTCGTACAAGCAATGGTAAAGCAGTCGTTT
TCTAAACCTCTGTTAATTACCAACGGCAATGGAGAGACGCCATTATGGCTAGCGGCCGCACACGGGCACCTGGAA
GTTGTCCAGTCAATTCTCCAATATCAGGACTTTGATCTGGACGTTCCTGACACTGGTGGGGAAACACCCTTCTGG
GTTGCGGCGTCGAACGGCCACACCGAGATTGTCAGATGCCTTGCGAACTCGGGTCGTGTGAATGTCAACCATCTA
AACAAAGCTGGCCTTTCTGCACTGTGGGCAGCGGTGTTCAACGGTCACGAAGACGTAGTTCAAGCCATGATTATC
ATGAAAAGCCTAGACCCGAACCATAGTGAATCTGGAGCGGGCGCCCCGCTGGAAGCAGCAATCCGTCTTGGAAAA
GAGAGGATGGTCAGGTTACTGGTTGGAAACGCAAGGACGGAGGTCGACCAGCAAATCCAGCATGGCAAGACGCCC
CTGCAGCTAGCAGCTGAGGAAGGATATGAGGAGATTCTGGCAATACTCGTCTCTACCCGTCGGGTAATACATAAT
CGGAGGGGTTATCAAGGCGTAACACCACTCTGGTCAGCTGCAGACTGTGGCCACAGTGGCGTTGTCAGGGTTCTG
GCTAATACGGAAGGAGTCGATCTGAACTTCCCACGCATGTATGGCAGTACAGCACTCTGGGCCGCGGCATCCAAT
GGACATGTGGAAGTAGTCCAGATCCTGATCTCCACCGGCCAGGTCGATCTCAATAGCAAGGGTCAGAGCGGCACA
ACGCCACTGTGGGCCGCTGCGGACAATGGCCATACTGAGGTCGTCAACGTCCTAGCAAGCACCGATGGGGTCGAT
ATGGACTGTCCCGACGATAAAGGAATTACGCCGCTCTGGAGCGCTGCATCGAACGGCTACTATCACATTGTTCAG
TCGCTGGTAAATACTGGCCGAGTGGCTATTAATAGCGTGGCTGCCAATGGCACAACACCCCTATGGGCGGCCGCT
GAGAATGGACATGACGACGTCGTCAGAACCCTCATCGATGTCGGTGTGAACTTGAATTGTACCGACATTGTGTCT
CATTCTCGCGCAAAGCAGACCCCTCTATGGATTGCCTCCTGCAATGGGCACACTGGCGTTGTGGAGATGCTGGTA
GCATGTCCTGGCGTTGAGCTCGACCGGCGCGATGAAGAGGGGTACACCCCGCTGGGGATTGCGGCGAAGATGGGC
CATGCGAGTGTCGTTGCTATCCTTCGCACGACGCCCGACCAGTCAGCTAAAAGCGATGCCCGAAGGCAATAA
Transcript >Ani_SJS100_1|g4277.t1
ATGACGACCGCTCTCACCAAAGCCGCGAGACTGAAACCTGAAGTCCGGTTGGGACAGGCCATCTCCGAGTTCCAA
GCGGACTGCTCCTCGCTGGAGAAGGCAACGCTGCGATCATTCCAGGCTGCTGGAATCCCGCCAGGTATCCGTGAT
GTGATGCAGTTGACTGCAGAGATCAACCGATCGGCTGGCCTCCAAGGACGATGTTTCGGATCACGGCTAACCAAC
ATTCTCCAGGCGGTGCAGGAGTTCGCTGCGCTTGGAGACATTGTCCTGGGCGCTTCGCAGAGCCTCCTAGCCTGT
GGCATCTGGGCATTGGTACGAATGTCACTTCTGTCCATCGTCAAGTACTCGGCCTACTTTGAACAGCTATCGGCC
ATGCTCATGGCCGTGGGCCGCTCTGCACCTCGTTATCAACTAATGGGCGCCGTCTATCCAAAGTCACAGCGTCTC
CGAACATCAATGCTGGAATACTTCATCACCGTTGTGCAGCTATGTCATCATGTCATAAAGTTGAGTCGGAAGACA
GCCTTCGGCCAGTGGGCTTCGACTATGACAACTCCCCTGAAAGGCTACCAATCTGACCTTGAGCTCTGGGCGGCC
GCCATCAAAGAAGAAGTGAATCTGCTTATGGTTCAGCAATTATCTCTGGAAGCCGAGGATAATTCATGGTTCAGG
TCTCAAGTCACTAAACGCTTTGAATCCCAATCGTACGCAAGAAAACTGAAAGCGCGCCAGCGCGTACTTGATGCT
TGTTCTACGTATGACTATGAACAAGACTGGAAGCGGATCCGCAAGCTCGGGACTACCACTATGCTGGAGACCTCG
GCTGTGTACGCGAATTGGAAAGCTCAACAATCTCCACAAGGGCTACAATCGCGTACACTCGTGTGTTCAGGCAAG
CTAGGATCGGGAAAGTCCGTCATTCTCGCAAATATGGTGGATGACCTCAACTTGGACGTGGGAAGGAAGCCAGTA
GTGGCGTACTTCTTCTGCCAACATGACTCGACGCAAAGCCTGGCCCCGAAAACAGTAATAGGGTCCTTAGCGCGA
CAACTGTTGCAATCGGAAAATGACTTCGATGTTGCGCGTGATTTCTTGGGAGACAAGCGTTCTCTCGAGGTTGAC
GAGATTCTAAGTTTACTAAAGCATCTACTGCCGACGCAGTTCGAGGCCGTTTTCATTCTTGACGGATTGATGCAC
TGCGATGCGGAAGCGCGACAAGTCATCTTGACATCTTTACAGGAGATCCAGAACCTGATCAAGCTGTCATTGTGC
GTTTCTGTCAGGCCAGAGCCCGCCGACTCTCTGCAGGAACTAAAACAGCTCTCGAACCAGCAGTTTCTTCCCGTT
GAGGATAATAAACCCGACATTGATGCTTTCATCAACGCCGAATTAGAGAGATGTCTCGAATCCGGAAAGCTTGTA
ATAAACGACCCCGCCCTTATTCTTGAGATTCGGGATAGTCTCTCTCAAGGAGCCCAGGGAATGTTCCTGTGGGCG
GCTCTGCAGATAGAAGCCCTGTGTCTTGAGAGAACAGACGCAGATATGCGAGAGGCAATTGCCAGTTTACCTAGA
GATCTCTCAGCCTTATACACTATGATACTAAAAAAATCTAGACTCTCCGACGTCACATATCAATCCAAAATTCTG
GATCTGGTTGCGATCGCGTGCAGGCCACTGACCACAGAGGAAATGAGAGAAGCCCTCAGTGTCGTTCCCTGGGAG
ACGACCTGGGACCCCGCGAGGAGATTGAATGACATCCATGCAACATTGGGCTGCTGTGGGAGTCTGCTTACTGTA
GACGAAGAAAGCTCGAGCATTCGAGTGGTGCATCATAGTGTGAAAAAATTTATATTCGACCACACCGGAGGAGGG
CTTAATGTGAATCGCGCAAATCAAACCATGGCAGGGATCATCGTCACCTACCTGAATTATGAAGTGTTCTCCAGG
CAGTTGTCGACAGTCAAGGTACCTAAAATCAGCTCCAGCTCAGTCACAGCGGCGGTGGTCAACTCGACCGTTCCC
GCTCGTCGCCAATCCCAAAGCTTTGCATTGAAGCTGTTGAGACTGAAGAAGAGCAAGGATACGGACGTTGGCTAC
AGTCTCTTGCAATACCTGCAAGCCTCCAGAGCAAGTGACACCGTGCCCTGGGCCCTTTACCAATATTCAGTGGCA
TGGTGGCAGGAGCATATTTGGTATCTTGACCTCGATTTGCCTAACCTACACAAGCTCCTGATCAATTTATTGGAG
GTTCATGACTATGACAAACCGGACTTCAATGGCCGGACGCCGTTGTCACATGCCTCTCAGAGCGGGAGTCTGGCT
CTCGTTAACTGGCTCCTCGCTCGTGGTGCTCGCCATACCGCCGACCTTGCAGGACAATCACCGCTATCTTGGGCC
ATCAATGGGAGACATCTGGCTGTGATCGACACCCTCTTGAAGAGTGAAGCCGTGGATCCGAGTGTAATAGATTGG
TCAGGGGAAACGCCTCTCATCTCTGTCATAATGATGAGAGATCTCGAGGCACTCAATTGCTTCTGTGATTGTGGG
GCTCGGATTGATTGGAACCAAACAGGTTCCAACGGATATACGCCTCTTATGACCGCTACGCTTATCAACTTTGTG
GAAGCAATACTGGCGCTCTTAAAACGCTTGGGGCCACATATCCTCACCCAGTCTCCAATTGGAGACACGGCCCTT
CATCTCGCTGCCCGTAAGGGCTACGCGGAGGCTTTCAAATTCATCCTCGTACAAGCAATGGTAAAGCAGTCGTTT
TCTAAACCTCTGTTAATTACCAACGGCAATGGAGAGACGCCATTATGGCTAGCGGCCGCACACGGGCACCTGGAA
GTTGTCCAGTCAATTCTCCAATATCAGGACTTTGATCTGGACGTTCCTGACACTGGTGGGGAAACACCCTTCTGG
GTTGCGGCGTCGAACGGCCACACCGAGATTGTCAGATGCCTTGCGAACTCGGGTCGTGTGAATGTCAACCATCTA
AACAAAGCTGGCCTTTCTGCACTGTGGGCAGCGGTGTTCAACGGTCACGAAGACGTAGTTCAAGCCATGATTATC
ATGAAAAGCCTAGACCCGAACCATAGTGAATCTGGAGCGGGCGCCCCGCTGGAAGCAGCAATCCGTCTTGGAAAA
GAGAGGATGGTCAGGTTACTGGTTGGAAACGCAAGGACGGAGGTCGACCAGCAAATCCAGCATGGCAAGACGCCC
CTGCAGCTAGCAGCTGAGGAAGGATATGAGGAGATTCTGGCAATACTCGTCTCTACCCGTCGGGTAATACATAAT
CGGAGGGGTTATCAAGGCGTAACACCACTCTGGTCAGCTGCAGACTGTGGCCACAGTGGCGTTGTCAGGGTTCTG
GCTAATACGGAAGGAGTCGATCTGAACTTCCCACGCATGTATGGCAGTACAGCACTCTGGGCCGCGGCATCCAAT
GGACATGTGGAAGTAGTCCAGATCCTGATCTCCACCGGCCAGGTCGATCTCAATAGCAAGGGTCAGAGCGGCACA
ACGCCACTGTGGGCCGCTGCGGACAATGGCCATACTGAGGTCGTCAACGTCCTAGCAAGCACCGATGGGGTCGAT
ATGGACTGTCCCGACGATAAAGGAATTACGCCGCTCTGGAGCGCTGCATCGAACGGCTACTATCACATTGTTCAG
TCGCTGGTAAATACTGGCCGAGTGGCTATTAATAGCGTGGCTGCCAATGGCACAACACCCCTATGGGCGGCCGCT
GAGAATGGACATGACGACGTCGTCAGAACCCTCATCGATGTCGGTGTGAACTTGAATTGTACCGACATTGTGTCT
CATTCTCGCGCAAAGCAGACCCCTCTATGGATTGCCTCCTGCAATGGGCACACTGGCGTTGTGGAGATGCTGGTA
GCATGTCCTGGCGTTGAGCTCGACCGGCGCGATGAAGAGGGGTACACCCCGCTGGGGATTGCGGCGAAGATGGGC
CATGCGAGTGTCGTTGCTATCCTTCGCACGACGCCCGACCAGTCAGCTAAAAGCGATGCCCGAAGGCAATAA
Gene >Ani_SJS100_1|g4277.t1
ATGACGACCGCTCTCACCAAAGCCGCGAGACTGAAACCTGAAGTCCGGTTGGGACAGGCCATCTCCGAGTTCCAA
GCGGACTGCTCCTCGCTGGAGAAGGCAACGCTGCGATCATTCCAGGCTGCTGGAATCCCGCCAGGTATCCGTGAT
GTGATGCAGTTGACTGCAGAGATCAACCGATCGGCTGGCCTCCAAGGACGATGTTTCGGATCACGGCTAACCAAC
ATTCTCCAGGCGGTGCAGGAGTTCGCTGCGCTTGGAGACATTGTCCTGGGCGCTTCGCAGAGCCTCCTAGCCTGT
GGCATCTGGGCATTGGTACGAATGTCACTTCTGGTAAGTATGCTGCAGCATGCATGTCACTCGGCGGAAGCCTCT
GATGAGGTTCTCAGTCCATCGTCAAGTACTCGGCCTACTTTGAACAGCTATCGGCCATGCTCATGGCCGTGGGCC
GCTCTGCACCTCGTTATCAACTAATGGGCGCCGTCTATCCAAAGTCACAGCGTCTCCGAACATCAATGCTGGAAT
ACTTCATCACCGTTGTGCAGCTATGTCATCATGTCATAAAGTTGAGTCGGAAGACAGCCTTCGGCCAGTGGGCTT
CGACTATGACAACTCCCCTGAAAGGCTACCAATCTGACCTTGAGCTCTGGGCGGCCGCCATCAAAGAAGAAGTGA
ATCTGCTTATGGTTCAGCAATTATCTCTGGAAGCCGAGGATAATTCATGGTTCAGGTCTCAAGTCACTAAACGCT
TTGAATCCCAATCGTACGCAAGAAAACTGAAAGCGCGCCAGCGCGTACTTGATGCTTGTTCTACGTATGACTATG
AACAAGACTGGAAGCGGATCCGCAAGCTCGGGACTACCACTATGCTGGAGACCTCGGCTGTGTACGCGAATTGGA
AAGCTCAACAATCTCCACAAGGGCTACAATCGCGTACACTCGTGTGTTCAGGCAAGCTAGGATCGGGAAAGTCCG
TCATTCTCGCAAATATGGTGGATGACCTCAACTTGGACGTGGGAAGGAAGCCAGTAGTGGCGTACTTCTTCTGCC
AACATGACTCGACGCAAAGCCTGGCCCCGAAAACAGTAATAGGGTCCTTAGCGCGACAACTGTTGCAATCGGAAA
ATGACTTCGATGTTGCGCGTGATTTCTTGGGAGACAAGCGTTCTCTCGAGGTTGACGAGATTCTAAGTTTACTAA
AGCATCTACTGCCGACGCAGTTCGAGGCCGTTTTCATTCTTGACGGATTGATGCACTGCGATGCGGAAGCGCGAC
AAGTCATCTTGACATCTTTACAGGAGATCCAGAACCTGATCAAGCTGTCATTGTGCGTTTCTGTCAGGCCAGAGC
CCGCCGACTCTCTGCAGGAACTAAAACAGCTCTCGAACCAGCAGTTTCTTCCCGTTGAGGATAATAAACCCGACA
TTGATGCTTTCATCAACGCCGAATTAGAGAGATGTCTCGAATCCGGAAAGCTTGTAATAAACGACCCCGCCCTTA
TTCTTGAGATTCGGGATAGTCTCTCTCAAGGAGCCCAGGGAATGTTCCTGTGGGCGGCTCTGCAGATAGAAGCCC
TGTGTCTTGAGAGAACAGACGCAGATATGCGAGAGGCAATTGCCAGTTTACCTAGAGATCTCTCAGCCTTATACA
CTATGATACTAAAAAAATCTAGACTCTCCGACGTCACATATCAATCCAAAATTCTGGATCTGGTTGCGATCGCGT
GCAGGCCACTGACCACAGAGGAAATGAGAGAAGCCCTCAGTGTCGTTCCCTGGGAGACGACCTGGGACCCCGCGA
GGAGATTGAATGACATCCATGCAACATTGGGCTGCTGTGGGAGTCTGCTTACTGTAGACGAAGAAAGCTCGAGCA
TTCGAGTGGTGCATCATAGTGTGAAAAAATTTATATTCGACCACACCGGAGGAGGGCTTAATGTGAATCGCGCAA
ATCAAACCATGGCAGGGATCATCGTCACCTACCTGAATTATGAAGTGTTCTCCAGGCAGTTGTCGACAGTCAAGG
TACCTAAAATCAGCTCCAGCTCAGTCACAGCGGCGGTGGTCAACTCGACCGTTCCCGCTCGTCGCCAATCCCAAA
GCTTTGCATTGAAGCTGTTGAGACTGAAGAAGAGCAAGGATACGGACGTTGGCTACAGTCTCTTGCAATACCTGC
AAGCCTCCAGAGCAAGTGACACCGTGCCCTGGGCCCTTTACCAATATTCAGTGGCATGGTGGCAGGAGCATATTT
GGTATCTTGACCTCGATTTGCCTAACCTACACAAGCTCCTGATCAATTTATTGGAGGTTCATGACTATGACAAAC
CGGACTTCAATGGCCGGACGCCGTTGTCACATGCCTCTCAGAGCGGGAGTCTGGCTCTCGTTAACTGGCTCCTCG
CTCGTGGTGCTCGCCATACCGCCGACCTTGCAGGACAATCACCGCTATCTTGGGCCATCAATGGGAGACATCTGG
CTGTGATCGACACCCTCTTGAAGAGTGAAGCCGTGGATCCGAGTGTAATAGATTGGTCAGGGGAAACGCCTCTCA
TCTCTGTCATAATGATGAGAGATCTCGAGGCACTCAATTGCTTCTGTGATTGTGGGGCTCGGATTGATTGGAACC
AAACAGGTTCCAACGGATATACGCCTCTTATGACCGCTACGCTTATCAACTTTGTGGAAGCAATACTGGCGCTCT
TAAAACGCTTGGGGCCACATATCCTCACCCAGTCTCCAATTGGAGACACGGCCCTTCATCTCGCTGCCCGTAAGG
GCTACGCGGAGGCTTTCAAATTCATCCTCGTACAAGCAATGGTAAAGCAGTCGTTTTCTAAACCTCTGTTAATTA
CCAACGGCAATGGAGAGACGCCATTATGGCTAGCGGCCGCACACGGGCACCTGGAAGTTGTCCAGTCAATTCTCC
AATATCAGGACTTTGATCTGGACGTTCCTGACACTGGTGGGGAAACACCCTTCTGGGTTGCGGCGTCGAACGGCC
ACACCGAGATTGTCAGATGCCTTGCGAACTCGGGTCGTGTGAATGTCAACCATCTAAACAAAGCTGGCCTTTCTG
CACTGTGGGCAGCGGTGTTCAACGGTCACGAAGACGTAGTTCAAGCCATGATTATCATGAAAAGCCTAGACCCGA
ACCATAGTGAATCTGGAGCGGGCGCCCCGCTGGAAGCAGCAATCCGTCTTGGAAAAGAGAGGATGGTCAGGTTAC
TGGTTGGAAACGCAAGGACGGAGGTCGACCAGCAAATCCAGCATGGCAAGACGCCCCTGCAGCTAGCAGCTGAGG
AAGGATATGAGGAGATTCTGGCAATACTCGTCTCTACCCGTCGGGTAATACATAATCGGAGGGGTTATCAAGGCG
TAACACCACTCTGGTCAGCTGCAGACTGTGGCCACAGTGGCGTTGTCAGGGTTCTGGCTAATACGGAAGGAGTCG
ATCTGAACTTCCCACGCATGTATGGCAGTACAGCACTCTGGGCCGCGGCATCCAATGGACATGTGGAAGTAGTCC
AGATCCTGATCTCCACCGGCCAGGTCGATCTCAATAGCAAGGGTCAGAGCGGCACAACGCCACTGTGGGCCGCTG
CGGACAATGGCCATACTGAGGTCGTCAACGTCCTAGCAAGCACCGATGGGGTCGATATGGACTGTCCCGACGATA
AAGGAATTACGCCGCTCTGGAGCGCTGCATCGAACGGCTACTATCACATTGTTCAGTCGCTGGTAAATACTGGCC
GAGTGGCTATTAATAGCGTGGCTGCCAATGGCACAACACCCCTATGGGCGGCCGCTGAGAATGGACATGACGACG
TCGTCAGAACCCTCATCGATGTCGGTGTGAACTTGAATTGTACCGACATTGTGTCTCATTCTCGCGCAAAGCAGA
CCCCTCTATGGATTGCCTCCTGCAATGGGCACACTGGCGTTGTGGAGATGCTGGTAGCATGTCCTGGCGTTGAGC
TCGACCGGCGCGATGAAGAGGGGTACACCCCGCTGGGGATTGCGGCGAAGATGGGCCATGCGAGTGTCGTTGCTA
TCCTGTCCAGTATTCGAGGGGTGAAGCTGTCTCAAGTGGATAGAAACCGACAAAGTGCCTTGGAGCTCGCACGGC
AGTACGGCCATGAAGACGTGGTGAATGTGCTCGAGGCACGTAGACCACGCATAAGTGTTGGGCCAACCCCTCGCT
TATTTGACCGGGGAAGAATTGTTGTATGGTCAACCTGGAAGACTACAGATCGATCATCGATCGCTGCGACTGAAT
GTCAAGATGAACGCCACCATTTATGATCAGTCCATTAAACGGCCAGAAATGACCAGAAATGGCGGGCTTGCTCAC
GCATTGATCACGCACGTCTGCATTTTTCAGGGGCAAAGCTGCCATCTAGGTCTCAGACAAAATCGGCATAGGATG
GATACAGTTCAGCTCCTCCCGTTACCGCATTGGATAGGGGGTATCAACACTGGCGTACATGGCCTCGTCGTACGG
AGCTGTGTTCCACAAGTCGCTAACATGATCTGTATATCAGTGTCTTGGCAGTAATGCATAGGAACCAAAACATGC
ATAGATGTTTCAGCTGATGCATATAGGTTAAATCACCTGAAAGGGCTATATAGTGATTGTGGATCACGTGGTGCA
TATGTTATTATGCATTTCCAGCAGCAGTACTCCTGGAACACATGTCCGGCAATGCAGTATGCATGGTAGTCAAGA
TGACATATGATCGTGACTGAGTTTTGGAAAGCCTAGAAAAAGCAAACGTTCCCTCCACGCCATGGGAGTGATATG
ACAGTTAGAGCCCCTCTTCTGCCAACACATCGACGAGGTCGATTACAGTCGCACGACGCCCGACCAGTCAGCTAA
AGTCAGTGTATTCAACAAGGTCCATATCACAGACTGACGTCCAGGCCCCAGAGCGATGCCCGAAGGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail