Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4275.t1
Gene name
Locationscaffold_021:221946..222849
Strand-
Gene length (bp)903
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase 2.2E-51 78 235
PF02475 Met_10 Met-10+ like-protein 6.2E-11 77 221
PF03602 Cons_hypoth95 Conserved hypothetical protein 95 1.0E-07 75 160
PF01170 UPF0020 Putative RNA methylase family UPF0020 3.6E-05 100 159

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0001510 RNA methylation Yes
GO:0009452 7-methylguanosine RNA capping Yes
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0032259 methylation No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0036260 RNA capping No
GO:0043414 macromolecule methylation No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009451 RNA modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4275.t1
MARDPTVEVPPEEVHHYNDIGEVPWDIQNYWAQRYKIFSKYDEGVWLTDDAWFGVTPEPVANKIAEHMAQSAPAG
RSILVDAFAGAGGNSIAFALSGRWKRVYAIEKNPAVLQCAKHNAKIYGVADKITWFEGDCFEIIKNQLKDLAPYS
VVFASPPWGGPGYRSDTVFNLSTMEPYSLAKLYKEYSLFTEHIVLYLPRTSDVKQMAKVVKEGQKSVVMHYCMEG
ASKALCVYYGGFNLE*
Coding >Ani_SJS100_1|g4275.t1
ATGGCTCGAGACCCTACCGTGGAGGTTCCTCCGGAGGAAGTACATCATTACAATGATATCGGCGAGGTGCCCTGG
GATATTCAGAACTACTGGGCGCAACGCTACAAGATCTTTTCCAAGTATGATGAGGGTGTCTGGCTGACTGATGAT
GCCTGGTTTGGGGTAACACCCGAGCCAGTAGCCAACAAAATAGCAGAACACATGGCGCAATCCGCTCCCGCAGGA
CGCAGCATCCTAGTAGATGCATTCGCTGGCGCGGGCGGCAACTCAATCGCTTTCGCGCTGTCTGGTAGATGGAAG
CGTGTCTACGCCATCGAGAAGAACCCCGCTGTCTTGCAGTGCGCCAAACACAACGCCAAGATCTACGGCGTCGCA
GACAAGATCACCTGGTTCGAGGGAGATTGTTTCGAAATCATCAAGAATCAGCTGAAGGACTTGGCGCCGTATAGT
GTGGTGTTTGCCAGTCCCCCATGGGGTGGCCCCGGGTATCGCTCCGACACGGTGTTTAATCTGAGTACGATGGAG
CCGTACTCTCTCGCAAAACTTTACAAAGAGTATTCTCTGTTCACAGAACACATAGTTCTCTACCTTCCTCGGACA
TCGGACGTCAAGCAGATGGCCAAGGTTGTCAAGGAGGGCCAAAAGTCAGTGGTGATGCATTACTGCATGGAAGGT
GCTAGCAAGGCGTTGTGTGTTTATTATGGGGGCTTCAATCTCGAATGA
Transcript >Ani_SJS100_1|g4275.t1
ATGGCTCGAGACCCTACCGTGGAGGTTCCTCCGGAGGAAGTACATCATTACAATGATATCGGCGAGGTGCCCTGG
GATATTCAGAACTACTGGGCGCAACGCTACAAGATCTTTTCCAAGTATGATGAGGGTGTCTGGCTGACTGATGAT
GCCTGGTTTGGGGTAACACCCGAGCCAGTAGCCAACAAAATAGCAGAACACATGGCGCAATCCGCTCCCGCAGGA
CGCAGCATCCTAGTAGATGCATTCGCTGGCGCGGGCGGCAACTCAATCGCTTTCGCGCTGTCTGGTAGATGGAAG
CGTGTCTACGCCATCGAGAAGAACCCCGCTGTCTTGCAGTGCGCCAAACACAACGCCAAGATCTACGGCGTCGCA
GACAAGATCACCTGGTTCGAGGGAGATTGTTTCGAAATCATCAAGAATCAGCTGAAGGACTTGGCGCCGTATAGT
GTGGTGTTTGCCAGTCCCCCATGGGGTGGCCCCGGGTATCGCTCCGACACGGTGTTTAATCTGAGTACGATGGAG
CCGTACTCTCTCGCAAAACTTTACAAAGAGTATTCTCTGTTCACAGAACACATAGTTCTCTACCTTCCTCGGACA
TCGGACGTCAAGCAGATGGCCAAGGTTGTCAAGGAGGGCCAAAAGTCAGTGGTGATGCATTACTGCATGGAAGGT
GCTAGCAAGGCGTTGTGTGTTTATTATGGGGGCTTCAATCTCGAATGA
Gene >Ani_SJS100_1|g4275.t1
ATGGCTCGAGACCCTACCGTGGAGGTTCCTCCGGAGGAAGTACATCATTACAATGATATCGGCGAGGTGCCCTGG
GATATTCAGAAGTAAGACCATCATCCCCCGTCTATATGTTGCGGAACTGAAATCGACTAACACTGGCGCAACAGC
TACTGGGCGCAACGCTACAAGATCTTTTCCAAGTATGATGAGGGTGTCTGGCTGACTGATGATGCCTGGTTTGGG
GTAACACCCGAGCCAGTAGCCAAGTAGGTGTTCCATCATCTACTCACAGGATCCGGGTAGCTAATACACCACGGC
AGCAAAATAGCAGAACACATGGCGCAATCCGCTCCCGCAGGACGCAGCATCCTAGTAGATGCATTCGCTGGCGCG
GGCGGCAACTCAATCGCTTTCGCGCTGTCTGGTAGATGGAAGCGTGTCTACGCCATCGAGAAGAACCCCGCTGTC
TTGCAGTGCGCCAAACACAACGCCAAGATCTACGGCGTCGCAGACAAGATCACCTGGTTCGAGGGAGATTGTTTC
GAAATCATCAAGAATCAGCTGAAGGACTTGGCGCCGTATAGTGTGGTGTTTGCCAGTCCCCCATGGGGTGGTATG
TGTCCAAACCATTCGCTTAACCTTCTAGGTACCTTGGCAGCAAGCTGATCCAATTTAGGCCCCGGGTATCGCTCC
GACACGGTGTTTAATCTGAGTACGATGGAGCCGTACTCTCTCGCAAAACTTTACAAAGAGTATTCTCTGTTCACA
GAACACATAGTTCTCTACCTTCCTCGGACATCGGACGTCAAGCAGATGGCCAAGGTTGTCAAGGAGGGCCAAAAG
TCAGTGGTGATGCATTACTGCATGGAAGGTGCTAGCAAGGCGTTGTGTGTTTATTATGGGGGCTTCAATCTCGAA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail