Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4273.t1
Gene name
Locationscaffold_021:218378..220040
Strand-
Gene length (bp)1662
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 7.6E-66 5 304
PF05199 GMC_oxred_C GMC oxidoreductase 2.3E-33 409 547
PF05834 Lycopene_cycl Lycopene cyclase protein 3.6E-06 6 41

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4273.t1
MPDSYDYIIVGGGLTGCALAGRLAEKDKSLQMLIIEAGPNVVDNPLTSTPLACFGAHHSPLDWDYTTVPQKHLNN
RECYNAAGKALGGGTAINYGTWTRGNAADYNLWAKLVGDSSWSYEGLLPYFKRVETHYDPNVDTAIHGTSGPITN
TIVALTSPDRKYPLKEPVRSAWERIGVKFNPDANAGSPLGLAHFGENWREGQRQLASEAYGLSRRQGISIVTDTL
AAKVIFQEQDGQQVAAGVQLVDGEEYHARREVIISAGTYRTPQLLMLSGIGPAEELAKHSIPQLVNSPEVGRNFH
DHMCFPQWWKLRHPEQGLSMGTPLWNSPAYGMGVPYDWNVTLQTPAEELIKAFQADDGQIPPNDHPYLDTGFAHS
EVLVIYAPMSRAVTGFETAMDGTHISTAVLLMAPTARGQITLADADPASAPLIDPNYCSKEVDRAILRDGIRRVA
KLILDTPEGQDMVEHEVTRPGNEPMRLDSTDEEIDNNIRNGAITFFHPGGSASMGKVVDTQLRVKGVKGLRVADA
SVLPVPLAAHYQAVLYAVAEKAADLLLY*
Coding >Ani_SJS100_1|g4273.t1
ATGCCTGACTCTTACGATTACATCATTGTCGGTGGAGGTCTGACGGGCTGTGCTTTGGCTGGTCGGCTGGCTGAG
AAAGACAAGTCATTACAGATGTTGATCATTGAAGCCGGACCCAACGTCGTCGATAATCCTCTCACCAGTACCCCA
TTGGCATGCTTTGGTGCTCATCACTCGCCTTTGGATTGGGACTATACCACGGTGCCACAAAAGCATCTCAACAAT
CGTGAATGCTACAACGCGGCAGGGAAGGCTCTGGGTGGAGGCACAGCGATAAACTACGGCACCTGGACCCGTGGT
AACGCTGCCGACTACAATCTCTGGGCAAAGCTGGTCGGGGACTCTAGCTGGAGCTACGAGGGTCTACTTCCTTAC
TTCAAGCGCGTCGAGACGCATTACGATCCTAATGTCGACACGGCAATTCACGGCACCAGCGGCCCCATAACCAAC
ACAATTGTCGCACTCACCAGCCCGGACCGGAAATATCCTCTGAAAGAGCCAGTCCGCTCTGCATGGGAACGTATT
GGCGTCAAGTTCAACCCAGATGCAAACGCTGGAAGCCCGCTAGGTCTAGCTCACTTTGGGGAGAACTGGCGTGAA
GGACAGCGTCAGCTTGCCAGTGAGGCATATGGATTGTCTCGGCGTCAAGGAATATCCATTGTCACTGATACACTG
GCGGCAAAGGTAATTTTCCAGGAGCAAGATGGTCAACAGGTCGCGGCAGGAGTCCAATTGGTCGATGGAGAAGAA
TACCATGCCAGAAGAGAGGTGATCATTTCTGCTGGAACATACCGTACCCCTCAGCTTCTCATGCTCTCGGGAATT
GGGCCCGCAGAAGAGCTGGCAAAACACAGCATCCCACAACTTGTGAACTCTCCAGAAGTGGGTCGAAACTTCCAT
GATCACATGTGTTTCCCCCAATGGTGGAAACTGCGTCACCCCGAACAAGGTCTCTCTATGGGGACGCCCCTTTGG
AACAGTCCCGCATATGGCATGGGGGTACCTTATGACTGGAACGTGACGCTGCAGACGCCTGCAGAGGAATTGATC
AAAGCATTTCAAGCAGACGACGGGCAAATCCCGCCTAATGATCATCCATATCTTGACACGGGCTTTGCGCACTCT
GAGGTTCTGGTTATCTACGCACCGATGAGTCGCGCTGTGACTGGCTTTGAAACAGCCATGGATGGTACACACATA
AGCACGGCGGTTCTTTTGATGGCTCCGACAGCACGAGGCCAGATCACTCTGGCCGATGCAGATCCGGCCAGTGCA
CCTCTCATTGATCCCAACTACTGTTCCAAGGAAGTGGACCGAGCCATTCTACGAGACGGGATTCGGAGAGTTGCC
AAGCTCATCCTGGACACGCCGGAGGGTCAAGACATGGTGGAGCACGAAGTGACCAGACCCGGCAATGAACCTATG
AGACTCGATTCCACTGACGAGGAAATCGACAACAACATCAGAAATGGTGCAATTACATTCTTCCATCCAGGTGGC
TCGGCATCCATGGGCAAGGTAGTGGATACTCAACTGCGGGTGAAGGGCGTGAAGGGATTGCGTGTTGCGGATGCT
AGTGTCCTGCCTGTACCTCTTGCGGCGCATTATCAGGCTGTCCTTTATGCAGTGGCGGAGAAGGCAGCGGATCTA
CTCTTATACTAG
Transcript >Ani_SJS100_1|g4273.t1
ATGCCTGACTCTTACGATTACATCATTGTCGGTGGAGGTCTGACGGGCTGTGCTTTGGCTGGTCGGCTGGCTGAG
AAAGACAAGTCATTACAGATGTTGATCATTGAAGCCGGACCCAACGTCGTCGATAATCCTCTCACCAGTACCCCA
TTGGCATGCTTTGGTGCTCATCACTCGCCTTTGGATTGGGACTATACCACGGTGCCACAAAAGCATCTCAACAAT
CGTGAATGCTACAACGCGGCAGGGAAGGCTCTGGGTGGAGGCACAGCGATAAACTACGGCACCTGGACCCGTGGT
AACGCTGCCGACTACAATCTCTGGGCAAAGCTGGTCGGGGACTCTAGCTGGAGCTACGAGGGTCTACTTCCTTAC
TTCAAGCGCGTCGAGACGCATTACGATCCTAATGTCGACACGGCAATTCACGGCACCAGCGGCCCCATAACCAAC
ACAATTGTCGCACTCACCAGCCCGGACCGGAAATATCCTCTGAAAGAGCCAGTCCGCTCTGCATGGGAACGTATT
GGCGTCAAGTTCAACCCAGATGCAAACGCTGGAAGCCCGCTAGGTCTAGCTCACTTTGGGGAGAACTGGCGTGAA
GGACAGCGTCAGCTTGCCAGTGAGGCATATGGATTGTCTCGGCGTCAAGGAATATCCATTGTCACTGATACACTG
GCGGCAAAGGTAATTTTCCAGGAGCAAGATGGTCAACAGGTCGCGGCAGGAGTCCAATTGGTCGATGGAGAAGAA
TACCATGCCAGAAGAGAGGTGATCATTTCTGCTGGAACATACCGTACCCCTCAGCTTCTCATGCTCTCGGGAATT
GGGCCCGCAGAAGAGCTGGCAAAACACAGCATCCCACAACTTGTGAACTCTCCAGAAGTGGGTCGAAACTTCCAT
GATCACATGTGTTTCCCCCAATGGTGGAAACTGCGTCACCCCGAACAAGGTCTCTCTATGGGGACGCCCCTTTGG
AACAGTCCCGCATATGGCATGGGGGTACCTTATGACTGGAACGTGACGCTGCAGACGCCTGCAGAGGAATTGATC
AAAGCATTTCAAGCAGACGACGGGCAAATCCCGCCTAATGATCATCCATATCTTGACACGGGCTTTGCGCACTCT
GAGGTTCTGGTTATCTACGCACCGATGAGTCGCGCTGTGACTGGCTTTGAAACAGCCATGGATGGTACACACATA
AGCACGGCGGTTCTTTTGATGGCTCCGACAGCACGAGGCCAGATCACTCTGGCCGATGCAGATCCGGCCAGTGCA
CCTCTCATTGATCCCAACTACTGTTCCAAGGAAGTGGACCGAGCCATTCTACGAGACGGGATTCGGAGAGTTGCC
AAGCTCATCCTGGACACGCCGGAGGGTCAAGACATGGTGGAGCACGAAGTGACCAGACCCGGCAATGAACCTATG
AGACTCGATTCCACTGACGAGGAAATCGACAACAACATCAGAAATGGTGCAATTACATTCTTCCATCCAGGTGGC
TCGGCATCCATGGGCAAGGTAGTGGATACTCAACTGCGGGTGAAGGGCGTGAAGGGATTGCGTGTTGCGGATGCT
AGTGTCCTGCCTGTACCTCTTGCGGCGCATTATCAGGCTGTCCTTTATGCAGTGGCGGAGAAGGCAGCGGATCTA
CTCTTATACTAG
Gene >Ani_SJS100_1|g4273.t1
ATGCCTGACTCTTACGATTACATCATTGTCGGTGGAGGTCTGACGGGCTGTGCTTTGGCTGGTCGGCTGGCTGAG
AAAGACAAGTCATTACAGATGTTGATCATTGAAGCCGGACCCAACGTCGTCGATAATCCTCTCACCAGTACCCCA
TTGGCATGCTTTGGTGCTCATCACTCGCCTTTGGATTGGGACTATACCACGGTGCCACAAAAGCATCTCAACAAT
CGTGAATGCTACAACGCGGCAGGGAAGGCTCTGGGTGGAGGCACAGCGATAAACTACGGCACCTGGACCCGTGGT
AACGCTGCCGACTACAATCTCTGGGCAAAGCTGGTCGGGGACTCTAGCTGGAGCTACGAGGGTCTACTTCCTTAC
TTCAAGCGCGTCGAGACGCATTACGATCCTAATGTCGACACGGCAATTCACGGCACCAGCGGCCCCATAACCAAC
ACAATTGTCGCACTCACCAGCCCGGACCGGAAATATCCTCTGAAAGAGCCAGTCCGCTCTGCATGGGAACGTATT
GGCGTCAAGTTCAACCCAGATGCAAACGCTGGAAGCCCGCTAGGTCTAGCTCACTTTGGGGAGAACTGGCGTGAA
GGACAGCGTCAGCTTGCCAGTGAGGCATATGGATTGTCTCGGCGTCAAGGAATATCCATTGTCACTGATACACTG
GCGGCAAAGGTAATTTTCCAGGAGCAAGATGGTCAACAGGTCGCGGCAGGAGTCCAATTGGTCGATGGAGAAGAA
TACCATGCCAGAAGAGAGGTGATCATTTCTGCTGGAACATACCGTACCCCTCAGCTTCTCATGCTCTCGGGAATT
GGGCCCGCAGAAGAGCTGGCAAAACACAGCATCCCACAACTTGTGAACTCTCCAGAAGTGGGTCGAAACTTCCAT
GATCACATGTGTTTCCCCCAATGGTGGAAACTGCGTCACCCCGAACAAGGTCTCTCTATGGGGACGCCCCTTTGG
AACAGTCCCGCATATGGCATGGGGGTACCTTATGACTGGAACGTGACGCTGCAGACGCCTGCAGAGGAATTGATC
AAAGCATTTCAAGCAGACGACGGGCAAATCCCGCCTAATGATCATCCATATCTTGACACGGGCTTTGCGCACTCT
GAGGTTCTGGTTATCTACGCACCGATGAGTCGCGCTGTGACTGGCTTTGAAACAGCCATGGATGGTACACACATA
AGCACGGCGGTTCTTTTGATGGCTCCGACAGCACGAGGCCAGATCACTCTGGCCGATGCAGATCCGGCCAGTGCA
CCTCTCATTGATCCCAACTACTGTTCCAAGGAAGTGGACCGAGCCATTCTACGAGACGGGATTCGGAGAGTTGCC
AAGCTCATCCTGGACACGCCGGAGGGTCAAGACATGGTGGAGCACGAAGTGACCAGACCCGGCAATGAACCTATG
AGACTCGATTCCACTGACGAGGAAATCGACAACAACATCAGAAATGGTGCAATTACATTCTTCCATCCAGGTGGC
TCGGCATCCATGGGCAAGGTAGTGGATACTCAACTGCGGGTGAAGGGCGTGAAGGGATTGCGTGTTGCGGATGCT
AGTGTCCTGCCTGTACCTCTTGCGGCGCATTATCAGGCTGTCCTTTATGCAGTGGCGGAGAAGGCAGCGGATCTA
CTCTTATACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail