Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4270.t1
Gene name
Locationscaffold_021:203679..205125
Strand-
Gene length (bp)1446
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 2.6E-30 59 408

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0009058 biosynthetic process Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0008152 metabolic process No
GO:0019842 vitamin binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4270.t1
MPPSSTGTWKKSSTCAEPSTAASLHTKEQTSMVDFSSTDILGLSTSGSVRKGYLDELAQHPDFTLSSHGSRLTDG
NSRYLEDVERELAAFHGAEAALIVNTGSLGNAAIFSVIPRPGDAIVYDELIHASVHDGMKDSLALCRKAFRHNDA
ESLYDALVAVQESQPQIRNGTRSVLVAVESVYSMDGDICPLQELIETAKEVFPDGNVQFVIDEAHSTGVIGPNGA
GLVSALGLESEVAIRLHTFGKALAATGAVILCNETVRTMLINYARSIMFSVAPSFPMLASIRATYQLLRSGETQE
QAQDRVQEIVKFFLETMTSNPIWSRASDTGLLRLPTYEDADVQPFLTQIIQLRTRTKHNFYLAFHLQRAGFSVFP
ISYPVVPKGTERVRIIFHASNTDAEVNSLVAAIAEWAQEMLEIESSGDRTRVPAAARHVYALIAQANLNGSG*
Coding >Ani_SJS100_1|g4270.t1
ATGCCTCCGTCTTCTACCGGAACCTGGAAGAAGAGCTCGACGTGCGCCGAGCCCAGCACGGCTGCATCGCTGCAC
ACCAAAGAGCAAACCTCCATGGTGGACTTTTCCTCTACCGATATCCTCGGGCTGAGCACCTCGGGCTCCGTCCGC
AAAGGCTACCTGGACGAGCTGGCCCAACACCCCGATTTCACGCTCAGCAGCCACGGCTCACGTCTGACCGACGGC
AACTCCAGATACCTGGAAGACGTCGAGCGTGAGCTGGCTGCATTTCACGGCGCCGAGGCTGCGTTGATTGTCAAC
ACGGGGAGCCTGGGCAATGCCGCCATTTTCTCCGTTATTCCACGCCCCGGCGATGCCATTGTGTATGATGAGCTC
ATTCACGCCAGCGTGCACGATGGTATGAAGGACAGCTTGGCCCTGTGTCGCAAGGCCTTCCGCCACAATGATGCC
GAATCGCTGTATGATGCCCTGGTGGCCGTCCAGGAATCGCAGCCCCAGATCCGCAACGGCACCCGATCGGTTTTG
GTGGCGGTTGAGTCGGTCTATAGCATGGACGGGGATATCTGCCCGCTCCAGGAGCTGATTGAAACAGCCAAGGAG
GTGTTTCCGGACGGCAATGTTCAATTTGTCATTGACGAGGCGCACAGCACTGGGGTGATTGGGCCCAACGGTGCT
GGGTTGGTGAGCGCCCTGGGGCTGGAAAGCGAAGTGGCGATCCGACTGCATACGTTTGGGAAGGCGCTGGCTGCG
ACAGGAGCCGTAATCCTATGCAACGAGACCGTGCGCACAATGCTGATCAACTACGCCCGCAGCATCATGTTCTCC
GTGGCGCCGTCCTTCCCCATGCTGGCCTCCATTCGCGCTACATACCAGCTCCTGCGCAGTGGCGAGACACAAGAG
CAGGCCCAGGACCGCGTCCAGGAGATCGTGAAATTCTTCCTGGAGACCATGACCTCCAATCCGATCTGGAGCAGG
GCCAGCGACACCGGGCTTCTCCGTCTTCCCACGTACGAAGACGCGGATGTCCAACCATTCCTCACCCAAATCATC
CAGCTACGGACGCGCACCAAGCACAACTTCTACCTTGCGTTCCACCTGCAACGGGCCGGGTTCTCCGTTTTCCCT
ATCTCGTATCCGGTGGTACCCAAGGGGACGGAACGCGTTCGGATCATCTTCCATGCGTCGAACACGGACGCGGAG
GTGAATTCCCTGGTTGCTGCGATTGCGGAATGGGCCCAGGAGATGTTGGAGATTGAGAGTAGCGGGGATCGAACG
AGGGTGCCAGCTGCGGCGCGGCATGTGTATGCGTTGATTGCCCAGGCTAATCTGAATGGGAGCGGGTAG
Transcript >Ani_SJS100_1|g4270.t1
ATGCCTCCGTCTTCTACCGGAACCTGGAAGAAGAGCTCGACGTGCGCCGAGCCCAGCACGGCTGCATCGCTGCAC
ACCAAAGAGCAAACCTCCATGGTGGACTTTTCCTCTACCGATATCCTCGGGCTGAGCACCTCGGGCTCCGTCCGC
AAAGGCTACCTGGACGAGCTGGCCCAACACCCCGATTTCACGCTCAGCAGCCACGGCTCACGTCTGACCGACGGC
AACTCCAGATACCTGGAAGACGTCGAGCGTGAGCTGGCTGCATTTCACGGCGCCGAGGCTGCGTTGATTGTCAAC
ACGGGGAGCCTGGGCAATGCCGCCATTTTCTCCGTTATTCCACGCCCCGGCGATGCCATTGTGTATGATGAGCTC
ATTCACGCCAGCGTGCACGATGGTATGAAGGACAGCTTGGCCCTGTGTCGCAAGGCCTTCCGCCACAATGATGCC
GAATCGCTGTATGATGCCCTGGTGGCCGTCCAGGAATCGCAGCCCCAGATCCGCAACGGCACCCGATCGGTTTTG
GTGGCGGTTGAGTCGGTCTATAGCATGGACGGGGATATCTGCCCGCTCCAGGAGCTGATTGAAACAGCCAAGGAG
GTGTTTCCGGACGGCAATGTTCAATTTGTCATTGACGAGGCGCACAGCACTGGGGTGATTGGGCCCAACGGTGCT
GGGTTGGTGAGCGCCCTGGGGCTGGAAAGCGAAGTGGCGATCCGACTGCATACGTTTGGGAAGGCGCTGGCTGCG
ACAGGAGCCGTAATCCTATGCAACGAGACCGTGCGCACAATGCTGATCAACTACGCCCGCAGCATCATGTTCTCC
GTGGCGCCGTCCTTCCCCATGCTGGCCTCCATTCGCGCTACATACCAGCTCCTGCGCAGTGGCGAGACACAAGAG
CAGGCCCAGGACCGCGTCCAGGAGATCGTGAAATTCTTCCTGGAGACCATGACCTCCAATCCGATCTGGAGCAGG
GCCAGCGACACCGGGCTTCTCCGTCTTCCCACGTACGAAGACGCGGATGTCCAACCATTCCTCACCCAAATCATC
CAGCTACGGACGCGCACCAAGCACAACTTCTACCTTGCGTTCCACCTGCAACGGGCCGGGTTCTCCGTTTTCCCT
ATCTCGTATCCGGTGGTACCCAAGGGGACGGAACGCGTTCGGATCATCTTCCATGCGTCGAACACGGACGCGGAG
GTGAATTCCCTGGTTGCTGCGATTGCGGAATGGGCCCAGGAGATGTTGGAGATTGAGAGTAGCGGGGATCGAACG
AGGGTGCCAGCTGCGGCGCGGCATGTGTATGCGTTGATTGCCCAGGCTAATCTGAATGGGAGCGGGTAG
Gene >Ani_SJS100_1|g4270.t1
ATGCCTCCGTCTTCTACCGGAACCTGGAAGAAGAGCTCGACGTGCGCCGAGCCCAGCACGGCTGCATCGCTGCAC
ACCAAAGAGCAAACCTCCATGGTGGACTTTTCCTCTACCGATATCCTCGGGCTGAGCACCTCGGGCTCCGTCCGC
AAAGGCTACCTGGACGAGCTGGCCCAACACCCCGATTTCACGCTCAGCAGCCACGGCTCACGTCTGACCGACGGC
AACTCCAGATACCTGGAAGACGTCGAGCGTGAGCTGGCTGCATTTCACGGCGCCGAGGCTGCGTTGATTGTCAAC
ACGGGGAGCCTGGGCAATGCCGCCATTTTCTCCGTTATTCCACGCCCCGGCGATGCCATTGTGTATGATGAGCTC
ATTCACGCCAGCGTGCACGATGGTATGAAGGACAGCTTGGCCCTGTGTCGCAAGGCCTTCCGCCACAATGATGCC
GAATCGCTGTATGATGCCCTGGTGGCCGTCCAGGAATCGCAGCCCCAGATCCGCAACGGCACCCGATCGGTTTTG
GTGGCGGTTGAGTCGGTCTATAGCATGGACGGGGATATCTGCCCGCTCCAGGAGCTGATTGAAACAGCCAAGGAG
GTGTTTCCGGACGGCAATGTTCAATTTGTCATTGACGAGGCGCACAGCACTGGGGTGATTGGGCCCAACGGTGCT
GGGTTGGTGAGCGCCCTGGGGCTGGAAAGCGAAGTGGCGATCCGACTGCATACGTTTGGGAAGGCGCTGGCTGCG
ACAGGAGGTAAGACACGATTGAACCGGTGTTGCTGAAGGATACACTGACTTGACTCGGTAGCCGTAATCCTATGC
AACGAGACCGTGCGCACAATGCTGATCAACTACGCCCGCAGCATCATGTTCTCCGTGGCGCCGTCCTTCCCCATG
CTGGCCTCCATTCGCGCTACATACCAGCTCCTGCGCAGTGGCGAGACACAAGAGGTATAATGTGGCTCCCTACTT
TACCGAAAGCTTAAGCTGACACGGCAGCAGGCCCAGGACCGCGTCCAGGAGATCGTGAAATTCTTCCTGGAGACC
ATGACCTCCAATCCGATCTGGAGCAGGGCCAGCGACACCGGGCTTCTCCGTCTTCCCACGTACGAAGACGCGGAT
GTCCAACCATTCCTCACCCAAATCATCCAGCTACGGACGCGCACCAAGCACAACTTCTACCTTGCGTTCCACCTG
CAACGGGCCGGGTTCTCCGTTTTCCCTATCTCGTATCCGGTGGTACCCAAGGGGACGGAACGCGTTCGGATCATC
TTCCATGCGTCGAACACGGACGCGGAGGTGAATTCCCTGGTTGCTGCGATTGCGGAATGGGCCCAGGAGATGTTG
GAGATTGAGAGTAGCGGGGATCGAACGAGGGTGCCAGCTGCGGCGCGGCATGTGTATGCGTTGATTGCCCAGGCT
AATCTGAATGGGAGCGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail