Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4189.t1
Gene name
Locationscaffold_020:388616..390798
Strand-
Gene length (bp)2182
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 5.7E-91 193 647

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0044238 primary metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006082 organic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0009987 cellular process No
GO:0017076 purine nucleotide binding No
GO:0016874 ligase activity No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0019752 carboxylic acid metabolic process No
GO:0008152 metabolic process No
GO:0043038 amino acid activation No
GO:0032555 purine ribonucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0034660 ncRNA metabolic process No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043039 tRNA aminoacylation No
GO:0003824 catalytic activity No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4189.t1
MYLARAVRCPPHLRATYVEISNYFRGRQLGRLSALQAHTSPVRSFHDFSEKHRSNVTSSEFLDKFKQSMEFPQTT
LDIDTLYSQDYEGQFVLLHGYLDKRDDMGKELSFARLYDHTMGRTIQLLSNSQSNTLPQLKKISRGSPVVVQGTV
KRRVTKTAEEERNDYLEIALESIQPLNEFPREIVLFGKNIVHPPKHRHLQLRSDKELRDALRFRAQARNVCRETL
EQLKPAFVEIETPLLFKSTPEGAREFIVPTRKRGKAYALPQSPQQYKQILMASGIPRYFQFARCFRDEDLRADRQ
PEFTQLDLEMAFAAGQDVMAVVEEIIRGLWGNMMREPVPSGPFRRMTYQEAMTRYGSDKPDTRHGMEIHRVEHLL
PADLVSKITPLTDPIVEAFKMDTVEQLPSATREFVSRFFDSTEGEPFNKNPDGAPGIFIYDEGQPLKGLGPLGFE
AAEKIQEMLDLSHGDLLILQARPQGPFAGGATQLGSIRRAMAAASISEELREVPPGFEFLWIVDFPLFSPTDASE
PGQGGTAGLSATHHPFTAPKTSSDVDLLSKDPTKALADHYDLVVNGVELGGGSRRIHCALTQNYIFKEILKMPKE
RIDEFQHLLNALWAGCPPHAGFALGFDRLITVMLGKESVRDVIAFPKIGKKGEDAMVKAPGKISEEVARLYNIKL
K*
Coding >Ani_SJS100_1|g4189.t1
ATGTATCTCGCCAGGGCGGTCCGATGCCCCCCTCATCTCCGCGCGACCTACGTGGAGATCTCCAACTACTTCCGC
GGCAGACAACTCGGTCGGCTTTCAGCATTGCAGGCTCACACCTCCCCTGTGCGATCGTTCCATGATTTCAGTGAA
AAGCACCGCTCCAATGTGACCTCGTCGGAGTTCCTAGATAAGTTCAAGCAATCGATGGAATTCCCCCAGACAACA
TTGGATATCGACACTTTGTATTCGCAGGATTACGAAGGCCAATTCGTACTCCTCCATGGCTACCTGGACAAACGC
GATGACATGGGGAAAGAGCTCTCGTTCGCCCGCTTGTATGATCACACAATGGGTCGTACCATACAGCTTCTCTCA
AACTCACAAAGCAATACTCTGCCCCAGCTCAAGAAGATCAGCAGGGGTAGCCCAGTGGTTGTTCAAGGGACAGTT
AAGCGCAGGGTGACAAAGACTGCCGAGGAGGAGCGCAACGATTACTTGGAGATCGCGCTGGAATCAATTCAACCG
CTAAACGAGTTTCCCCGCGAGATTGTGCTATTCGGAAAGAACATCGTTCACCCGCCTAAGCATCGCCACCTTCAA
CTGCGAAGCGATAAAGAGCTGCGTGATGCTCTCCGGTTCCGAGCGCAAGCGCGCAATGTCTGCCGGGAGACGCTG
GAACAGCTGAAGCCAGCGTTTGTTGAGATTGAGACACCTTTGCTGTTCAAGTCGACTCCGGAGGGTGCTCGTGAG
TTTATCGTCCCGACCAGGAAGAGGGGGAAAGCCTACGCTCTTCCTCAGAGTCCGCAGCAATATAAGCAGATTCTC
ATGGCAAGTGGAATCCCGAGATATTTCCAGTTCGCGCGCTGCTTCCGTGACGAAGATCTCCGCGCCGATAGACAG
CCGGAGTTCACTCAGCTGGATCTGGAAATGGCTTTTGCTGCCGGACAAGATGTCATGGCCGTTGTTGAGGAAATA
ATCCGCGGCCTGTGGGGGAACATGATGCGTGAGCCAGTCCCTTCAGGTCCGTTCCGTCGAATGACTTACCAGGAG
GCAATGACTCGCTATGGTTCGGACAAGCCGGACACCCGCCATGGAATGGAGATTCATCGTGTCGAGCACCTCCTT
CCTGCCGACCTTGTGTCGAAGATCACTCCTCTGACCGATCCAATCGTTGAAGCCTTCAAGATGGATACCGTCGAG
CAGCTACCGTCAGCAACTCGCGAATTTGTTTCACGGTTTTTCGACTCTACCGAGGGCGAGCCATTCAACAAGAAC
CCCGATGGTGCACCAGGAATATTCATCTACGACGAAGGACAACCCCTGAAGGGCCTGGGACCTCTCGGGTTCGAA
GCAGCCGAAAAGATCCAAGAGATGCTCGACCTTAGTCACGGCGACCTGCTCATCCTTCAAGCTCGCCCACAAGGC
CCTTTCGCCGGTGGTGCAACCCAACTCGGCAGCATCCGCCGCGCTATGGCTGCCGCCTCCATCTCCGAGGAACTA
AGAGAAGTGCCCCCAGGCTTCGAGTTCCTCTGGATAGTCGACTTCCCTCTATTCAGTCCCACGGATGCCTCCGAA
CCCGGCCAAGGTGGTACTGCCGGCCTCTCCGCCACCCATCACCCCTTCACAGCCCCGAAGACCTCTTCGGACGTC
GACCTCCTCAGCAAAGACCCCACTAAAGCCCTCGCGGACCACTACGACCTCGTTGTCAACGGCGTCGAGCTCGGC
GGCGGTAGTCGCCGTATTCATTGCGCCCTGACCCAGAACTACATCTTCAAGGAAATCCTCAAGATGCCCAAGGAG
CGCATCGACGAGTTCCAGCATCTCCTGAACGCCTTGTGGGCCGGATGTCCCCCGCACGCTGGGTTCGCGCTGGGC
TTCGATCGGCTCATCACTGTCATGTTGGGCAAGGAGTCGGTTAGGGATGTCATCGCGTTCCCGAAGATCGGAAAG
AAGGGCGAGGATGCGATGGTTAAAGCGCCTGGTAAGATCAGTGAGGAGGTCGCGAGGTTGTATAATATTAAGTTG
AAATGA
Transcript >Ani_SJS100_1|g4189.t1
ATGTATCTCGCCAGGGCGGTCCGATGCCCCCCTCATCTCCGCGCGACCTACGTGGAGATCTCCAACTACTTCCGC
GGCAGACAACTCGGTCGGCTTTCAGCATTGCAGGCTCACACCTCCCCTGTGCGATCGTTCCATGATTTCAGTGAA
AAGCACCGCTCCAATGTGACCTCGTCGGAGTTCCTAGATAAGTTCAAGCAATCGATGGAATTCCCCCAGACAACA
TTGGATATCGACACTTTGTATTCGCAGGATTACGAAGGCCAATTCGTACTCCTCCATGGCTACCTGGACAAACGC
GATGACATGGGGAAAGAGCTCTCGTTCGCCCGCTTGTATGATCACACAATGGGTCGTACCATACAGCTTCTCTCA
AACTCACAAAGCAATACTCTGCCCCAGCTCAAGAAGATCAGCAGGGGTAGCCCAGTGGTTGTTCAAGGGACAGTT
AAGCGCAGGGTGACAAAGACTGCCGAGGAGGAGCGCAACGATTACTTGGAGATCGCGCTGGAATCAATTCAACCG
CTAAACGAGTTTCCCCGCGAGATTGTGCTATTCGGAAAGAACATCGTTCACCCGCCTAAGCATCGCCACCTTCAA
CTGCGAAGCGATAAAGAGCTGCGTGATGCTCTCCGGTTCCGAGCGCAAGCGCGCAATGTCTGCCGGGAGACGCTG
GAACAGCTGAAGCCAGCGTTTGTTGAGATTGAGACACCTTTGCTGTTCAAGTCGACTCCGGAGGGTGCTCGTGAG
TTTATCGTCCCGACCAGGAAGAGGGGGAAAGCCTACGCTCTTCCTCAGAGTCCGCAGCAATATAAGCAGATTCTC
ATGGCAAGTGGAATCCCGAGATATTTCCAGTTCGCGCGCTGCTTCCGTGACGAAGATCTCCGCGCCGATAGACAG
CCGGAGTTCACTCAGCTGGATCTGGAAATGGCTTTTGCTGCCGGACAAGATGTCATGGCCGTTGTTGAGGAAATA
ATCCGCGGCCTGTGGGGGAACATGATGCGTGAGCCAGTCCCTTCAGGTCCGTTCCGTCGAATGACTTACCAGGAG
GCAATGACTCGCTATGGTTCGGACAAGCCGGACACCCGCCATGGAATGGAGATTCATCGTGTCGAGCACCTCCTT
CCTGCCGACCTTGTGTCGAAGATCACTCCTCTGACCGATCCAATCGTTGAAGCCTTCAAGATGGATACCGTCGAG
CAGCTACCGTCAGCAACTCGCGAATTTGTTTCACGGTTTTTCGACTCTACCGAGGGCGAGCCATTCAACAAGAAC
CCCGATGGTGCACCAGGAATATTCATCTACGACGAAGGACAACCCCTGAAGGGCCTGGGACCTCTCGGGTTCGAA
GCAGCCGAAAAGATCCAAGAGATGCTCGACCTTAGTCACGGCGACCTGCTCATCCTTCAAGCTCGCCCACAAGGC
CCTTTCGCCGGTGGTGCAACCCAACTCGGCAGCATCCGCCGCGCTATGGCTGCCGCCTCCATCTCCGAGGAACTA
AGAGAAGTGCCCCCAGGCTTCGAGTTCCTCTGGATAGTCGACTTCCCTCTATTCAGTCCCACGGATGCCTCCGAA
CCCGGCCAAGGTGGTACTGCCGGCCTCTCCGCCACCCATCACCCCTTCACAGCCCCGAAGACCTCTTCGGACGTC
GACCTCCTCAGCAAAGACCCCACTAAAGCCCTCGCGGACCACTACGACCTCGTTGTCAACGGCGTCGAGCTCGGC
GGCGGTAGTCGCCGTATTCATTGCGCCCTGACCCAGAACTACATCTTCAAGGAAATCCTCAAGATGCCCAAGGAG
CGCATCGACGAGTTCCAGCATCTCCTGAACGCCTTGTGGGCCGGATGTCCCCCGCACGCTGGGTTCGCGCTGGGC
TTCGATCGGCTCATCACTGTCATGTTGGGCAAGGAGTCGGTTAGGGATGTCATCGCGTTCCCGAAGATCGGAAAG
AAGGGCGAGGATGCGATGGTTAAAGCGCCTGGTAAGATCAGTGAGGAGGTCGCGAGGTTGTATAATATTAAGTTG
AAATGA
Gene >Ani_SJS100_1|g4189.t1
ATGTATCTCGCCAGGGCGGTCCGATGCCCCCCTCATCTCCGCGCGACCTACGTGGAGATCTCCAACTACTTCCGC
GGCAGACAACTCGGTCGGCTTTCAGCATTGCAGGCTCACACCTCCCCTGTGCGATCGTTCCATGATTTCAGTGAA
AAGCACCGCTCCAATGTGACCTCGTCGGAGTTCCTAGATAAGTTCAAGCAATCGAGTTCGTCATCCTGCCAACCA
ATGCAATCCTTCCAGCAGTTCTAGCACATACGACCAAGTTGCATCCTCGCACTCGGAAATGCTAACCTCCCGTTC
CCAAAGTGGAATTCCCCCAGACAACATTGGATATCGACACTTTGTATTCGCAGGATTACGAAGGCCAATTCGTAC
TCCTCCATGGCTACCTGGACAAACGCGATGACATGGGGAAAGAGCTCTCGTTCGCCCGCTTGTATGATCACACAA
TGGGTCGTACCATACAGCTTCTCTCAAACTCACAAAGCAATACTCTGCCCCAGCTCAAGAAGATCAGCAGGGGTA
GCCCAGTGGTTGTTCAAGGGACAGTTAAGCGCAGGGTGACAAAGACTGCCGAGGAGGAGCGCAACGATTACTTGG
AGATCGCGCTGGAATCAATTCAACCGCTAAACGAGTTTCCCCGCGAGATTGTGCTATTCGGAAAGAACATCGTTC
ACCCGCCTAAGCATCGCCACCTTCAACTGCGAAGCGATAAAGAGCTGCGTGATGCTCTCCGGTTCCGAGCGCAAG
CGCGCAATGTCTGCCGGGAGACGCTGGAACAGCTGAAGCCAGCGTTTGTTGAGATTGAGACACCTTTGCTGTTCA
AGTCGACTCCGGAGGGTGCTCGTGAGTTTATCGTCCCGACCAGGAAGAGGGGGAAAGCCTACGCTCTTCCTCAGA
GTCCGCAGCAATATAAGCAGATTCTCATGGCAAGTGGAATCCCGAGATATTTCCAGTTCGCGCGCTGCTTCCGTG
ACGAAGATCTCCGCGCCGATAGACAGCCGGAGTTCACTCAGGTAAGGTTCTAGTGACACCATATAGGATAACTGC
TGATTCAGGATTGTAGCTGGATCTGGAAATGGCTTTTGCTGCCGGACAAGATGTCATGGCCGTTGTTGAGGAAAT
AATCCGCGGCCTGTGGGGGAACATGATGCGTGAGCCAGTCCCTTCAGGTCCGTTCCGTCGAATGACTTACCAGGA
GGCAATGACTCGCTATGGTTCGGACAAGCCGGACACCCGCCATGGAATGGAGATTCATCGTGTCGAGCACCTCCT
TCCTGCCGACCTTGTGTCGAAGATCACTCCTCTGACCGATCCAATCGTTGAAGCCTTCAAGATGGATACCGTCGA
GCAGCTACCGTCAGCAACTCGCGAATTTGTTTCACGGTTTTTCGACTCTACCGAGGGCGAGCCATTCAACAAGAA
CCCCGATGGTGCACCAGGAATATTCATCTACGACGAAGGACAACCCCTGAAGGGCCTGGGACCTCTCGGGTTCGA
AGCAGCCGAAAAGATCCAAGAGATGCTCGACCTTAGTCACGGCGACCTGCTCATCCTTCAAGCTCGCCCACAAGG
CCCTTTCGCCGGTGGTGCAACCCAACTCGGCAGCATCCGCCGCGCTATGGCTGCCGCCTCCATCTCCGAGGAACT
AAGAGAAGTGCCCCCAGGCTTCGAGTTCCTCTGGATAGTCGACTTCCCTCTATTCAGTCCCACGGATGCCTCCGA
ACCCGGCCAAGGTGGTACTGCCGGCCTCTCCGCCACCCATCACCCCTTCACAGCCCCGAAGACCTCTTCGGACGT
CGACCTCCTCAGCAAAGACCCCACTAAAGCCCTCGCGGACCACTACGACCTCGTTGTCAACGGCGTCGAGCTCGG
CGGCGGTAGTCGCCGTATTCATTGCGCCCTGACCCAGAACTACATCTTCAAGGAAATCCTCAAGATGCCCAAGGA
GCGCATCGACGAGTTCCAGCATCTCCTGAACGCCTTGTGGGCCGGATGTCCCCCGCACGCTGGGTTCGCGCTGGG
CTTCGATCGGCTCATCACTGTCATGTTGGGCAAGGAGTCGGTTAGGGATGTCATCGCGTTCCCGAAGATCGGAAA
GAAGGGCGAGGATGCGATGGTTAAAGCGCCTGGTAAGATCAGTGAGGAGGTCGCGAGGTTGTATAATATTAAGTT
GAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail