Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4142.t1
Gene name
Locationscaffold_020:226541..227752
Strand-
Gene length (bp)1211
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 2.2E-17 22 76
PF04193 PQ-loop PQ loop repeat 1.8E-20 229 283

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 54 76 22
3 80 102 22
4 186 208 22
5 223 243 20
6 256 278 22
7 293 315 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4142.t1
MATLWTATNADSVPLTPREAASGLLGSISLTCWIFLLVPQLIENYRNGNAEAISLLFLFVWFLGDITNLIGGAWA
GLVPVIVAIAVYFCIADGVLIGQCLYYKARNSRQPRPRRRTSSSVFEPSTPDPTTPLLGRRFSDAYAHTQTGEIV
DNPRNSTRRAESSSDDMLAKIVEENDVGRKAWVKNFSSVLGICVIGMAGWTVAWRTGVWKPAPVEEGLGGVDMAP
GAMVLGYISAVCYLGARLPQIYKNYCDKSCEGLSLLFFILSLMGNLTYGAGIICHSTEKNYIVTNVPWLIGSLGT
MVEDVTIFVQFRLYATRDQDTAAV*
Coding >Ani_SJS100_1|g4142.t1
ATGGCGACTCTCTGGACAGCTACCAATGCTGACTCTGTCCCTCTCACTCCTCGCGAAGCAGCCTCCGGCTTGCTG
GGTTCAATATCACTCACCTGCTGGATCTTTCTCCTCGTCCCCCAACTAATCGAAAATTACCGCAACGGCAACGCC
GAAGCCATCTCCCTCCTCTTCCTCTTCGTCTGGTTCCTTGGCGACATCACAAACCTAATCGGAGGCGCCTGGGCA
GGTCTCGTGCCCGTGATCGTCGCCATCGCCGTGTACTTCTGTATCGCGGACGGGGTTCTCATCGGACAATGTCTC
TACTACAAGGCGCGGAACTCCCGACAGCCGCGCCCCCGCCGCCGCACCTCCTCTTCCGTATTTGAGCCAAGCACG
CCCGATCCGACGACGCCGCTTCTGGGCCGGCGGTTCAGCGATGCGTATGCGCATACGCAGACTGGTGAGATTGTG
GACAACCCTAGGAACTCGACGCGCCGCGCGGAAAGCAGCAGTGATGACATGCTGGCTAAGATTGTCGAGGAGAAT
GATGTGGGGCGCAAGGCGTGGGTGAAGAATTTTAGCAGTGTGCTGGGCATCTGCGTCATTGGGATGGCGGGGTGG
ACGGTTGCGTGGCGGACGGGCGTGTGGAAGCCTGCGCCTGTGGAGGAGGGGTTGGGAGGCGTGGATATGGCGCCT
GGGGCAATGGTGTTGGGGTATATTAGTGCGGTTTGTTATCTTGGGGCGCGACTTCCGCAGATCTACAAGAATTAC
TGCGATAAGTCGTGTGAGGGACTCTCGCTACTATTCTTCATCCTCTCCCTTATGGGAAACCTCACCTACGGCGCA
GGCATCATCTGTCACTCCACAGAAAAGAACTATATCGTGACAAATGTCCCATGGCTGATTGGTTCGCTCGGCACC
ATGGTCGAGGACGTGACTATCTTCGTGCAGTTCCGACTCTACGCGACACGCGACCAGGACACGGCTGCTGTTTAG
Transcript >Ani_SJS100_1|g4142.t1
ATGGCGACTCTCTGGACAGCTACCAATGCTGACTCTGTCCCTCTCACTCCTCGCGAAGCAGCCTCCGGCTTGCTG
GGTTCAATATCACTCACCTGCTGGATCTTTCTCCTCGTCCCCCAACTAATCGAAAATTACCGCAACGGCAACGCC
GAAGCCATCTCCCTCCTCTTCCTCTTCGTCTGGTTCCTTGGCGACATCACAAACCTAATCGGAGGCGCCTGGGCA
GGTCTCGTGCCCGTGATCGTCGCCATCGCCGTGTACTTCTGTATCGCGGACGGGGTTCTCATCGGACAATGTCTC
TACTACAAGGCGCGGAACTCCCGACAGCCGCGCCCCCGCCGCCGCACCTCCTCTTCCGTATTTGAGCCAAGCACG
CCCGATCCGACGACGCCGCTTCTGGGCCGGCGGTTCAGCGATGCGTATGCGCATACGCAGACTGGTGAGATTGTG
GACAACCCTAGGAACTCGACGCGCCGCGCGGAAAGCAGCAGTGATGACATGCTGGCTAAGATTGTCGAGGAGAAT
GATGTGGGGCGCAAGGCGTGGGTGAAGAATTTTAGCAGTGTGCTGGGCATCTGCGTCATTGGGATGGCGGGGTGG
ACGGTTGCGTGGCGGACGGGCGTGTGGAAGCCTGCGCCTGTGGAGGAGGGGTTGGGAGGCGTGGATATGGCGCCT
GGGGCAATGGTGTTGGGGTATATTAGTGCGGTTTGTTATCTTGGGGCGCGACTTCCGCAGATCTACAAGAATTAC
TGCGATAAGTCGTGTGAGGGACTCTCGCTACTATTCTTCATCCTCTCCCTTATGGGAAACCTCACCTACGGCGCA
GGCATCATCTGTCACTCCACAGAAAAGAACTATATCGTGACAAATGTCCCATGGCTGATTGGTTCGCTCGGCACC
ATGGTCGAGGACGTGACTATCTTCGTGCAGTTCCGACTCTACGCGACACGCGACCAGGACACGGCTGCTGTTTAG
Gene >Ani_SJS100_1|g4142.t1
ATGGCGACTCTCTGGACAGCTACCAATGCTGACTCTGTCCCTCTCACTCCTCGCGAAGCAGCCTCCGGCTTGCTG
GGTTCAATATCACTCACCTGCTGGATCTTTCTCCTCGTAAGCCCTCTAATCCTCTATTCCCTCCCCATACTACAA
GCCATACTAACAAGCTTCGAGGTCCCCCAACTAATCGAAAATTACCGCAACGGCAACGCCGAAGCCATCTCCCTC
CTCTTCCTCTTCGTCTGGTTCCTTGGCGACATCACAAACCTAATCGGAGGCGCCTGGGCAGGTCTCGTGCCCGTG
ATCGTCGCCATCGCCGTGTACTTCTGTATCGCGGACGGGGTTCTCATCGGACAATGTCTCTACTACAAGGCGCGG
AACTCCCGACAGCCGCGCCCCCGCCGCCGCACCTCCTCTTCCGTATTTGAGCCAAGCACGCCCGATCCGACGACG
CCGCTTCTGGGCCGGCGGTTCAGCGATGCGTATGCGCATACGCAGACTGGTGAGATTGTGGACAACCCTAGGAAC
TCGACGCGCCGCGCGGAAAGCAGCAGTGATGACATGCTGGCTAAGATTGTCGAGGAGAATGATGTGGGGCGCAAG
GCGTGGGTGAAGAATTTTAGCAGTGTGCTGGGCATCTGCGTCATTGGGATGGCGGGGTGGACGGTTGCGTGGCGG
ACGGGCGTGTGGAAGCCTGCGCCTGTGGAGGAGGGGTTGGGAGGCGTGGATATGGCGCCTGGGGCAATGGTGTTG
GGGTATATTAGTGCGGTTTGTTATCTTGGGTATGTTTACTTTTCTACGCTTGGTTGGGGAGAGTGATTGTGCTAA
TGGAATAATAGGGCGCGACTTCCGCAGATCTACAAGAATTACTGCGATAAGTCGTGTGAGGGTATGTACATCCCT
TCCTCTCTAATTGATTGTTGTGATGAGCTAACAGATATGGATATAGGACTCTCGCTACTATTCTTCATCCTCTCC
CTTATGGGAAACCTCACCTACGGCGCAGGCGTAAGTCTCACTTTCACTCCTCGTGACTCACATAAACCAGACTAA
CTGATCTTATACAGATCATCTGTCACTCCACAGAAAAGAACTATATCGTGACAAATGTCCCATGGCTGATTGGTT
CGCTCGGCACCATGGTCGAGGACGTGACTATCTTCGTGCAGTTCCGACTCTACGCGACACGCGACCAGGACACGG
CTGCTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail