Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4111.t1
Gene name
Locationscaffold_020:144823..148025
Strand-
Gene length (bp)3202
Transcript length (bp)3084
Coding sequence length (bp)3084
Protein length (aa) 1028

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11987 IF-2 Translation-initiation factor 2 1.4E-30 801 913
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.1E-27 512 669
PF04760 IF2_N Translation initiation factor IF-2, N-terminal region 3.5E-10 431 483
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.5E-07 512 618

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0017111 nucleoside-triphosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4111.t1
MHRRAALELSRRHGVEWSCATARRNAAFVPVVGLVPRRHFRISPLRLDSSESSPSNSPGDPVAGTSSSPAPSGPK
FGNRWGSKTQRPLGLSPAEQAIRDSLVAKKQQEEQQQRKQVQRQQQEQQRKERQQQSQQRWKEGRSQGRMEEQWP
STRWRDSGFKPRQSDAFPRRRSGHNNEDKESLSLQPDRSLEVNVNKVPKHKRSTSWTCPDCQTRCYGQHTVCPHC
KAARPNLHEGPQRHRASPRHRHADEEATKIRKLGQSVLSEKDGGNAEGLRPREAAFRGYMASQGQFAGPRPVFDS
NVDKEISAQEAREARKKEIEARKEEREAKKEERKAQQQSEEDKQEKKPADPWTWDASSLKNIKVREDEIPESKPK
RKVSRKQRESGRDEEDLFDEDEESQRRKRREEKKRLKKEKARKKEMQATTSPLYLPEFISVSTLADVIGVRPAQF
VRRMEEMGFDDVTYDHVLDAETAGLIASEYNYEPIFDTGEGDLTAAPEPEDKSNLPVRPPVVTIMGHVDHGKTTI
LDWLRKSSIVATEHGGITQHIGAFSVAMPSGKTITFLDTPGHAAFLDMRRRGADVTDIVVLVVAGDDSVKPQTIE
AIKHATSANVPIIVAMSKMDKEGVNPDRVKQDLSIHGVHVEDFGGDVQAIGVSGKTGQGMLELEEAIITLSEVLD
HRADPQGHVEGWVIEATTKSYGRVATVLVRRGTLRTGDIIVAGTTWARVRTLRNEAGQTVLEATPGMPVEVDGWR
EQPSAGTELLQADDEQHAKSVVDYRLERAETQKLSEDMTAINEARREKLEKRRQEEAGADQAEETVQSGPKPVQF
IIKADVGGSAEAVLNSVTAVGNNEVYANVLRSEVGPISEFDIEHAATANGHIISFNMPIEPAISRMAEKRGVNIM
NHNIIYKLIDDVKSILSEQLAPNVSQRVTGEAEIGQIFEITVKGRNKTAIAGCKVRNGTINRARKVRVIRGQETI
YDGSITSLKNVKKDVTEMRKDTECGIGFDGWTDFAVGDHIQCYEEVFEKRYL*
Coding >Ani_SJS100_1|g4111.t1
ATGCACAGGCGGGCTGCTTTGGAACTATCCCGCCGTCACGGTGTCGAATGGTCGTGCGCAACCGCCCGCAGAAAT
GCTGCCTTCGTTCCGGTAGTAGGCTTGGTTCCTCGACGGCATTTTCGAATCTCTCCTCTTCGCCTCGATTCTTCT
GAATCTTCGCCATCGAACAGTCCCGGTGACCCGGTTGCAGGTACAAGCTCCAGCCCTGCACCTTCAGGGCCGAAA
TTCGGTAATCGTTGGGGAAGCAAAACGCAGAGACCGCTTGGGCTGAGTCCGGCGGAGCAAGCCATCCGAGACTCA
TTAGTCGCAAAGAAGCAACAAGAAGAACAACAACAGCGGAAACAAGTACAGAGACAACAGCAAGAGCAGCAACGT
AAAGAAAGGCAGCAGCAATCGCAACAACGATGGAAGGAAGGGCGGTCCCAGGGCCGCATGGAAGAACAATGGCCG
AGCACGAGATGGCGTGATTCCGGCTTCAAGCCCAGGCAATCCGATGCCTTCCCCAGGCGGCGTTCGGGTCATAAC
AATGAGGATAAGGAAAGCCTGTCCCTCCAACCCGACAGATCGCTCGAGGTCAACGTCAACAAGGTGCCCAAGCAC
AAGCGGTCGACAAGTTGGACATGCCCGGACTGTCAGACGAGGTGTTACGGGCAGCATACCGTCTGCCCGCACTGC
AAAGCAGCCAGACCAAACCTGCACGAGGGGCCGCAACGGCACCGAGCCTCACCCCGCCATCGCCACGCAGACGAG
GAAGCCACAAAGATTCGGAAATTGGGCCAGTCTGTCTTGTCTGAGAAGGATGGCGGGAATGCTGAAGGTCTCCGT
CCAAGGGAAGCAGCCTTCAGGGGTTACATGGCAAGCCAAGGACAATTTGCCGGCCCACGGCCTGTGTTCGACTCT
AATGTCGATAAAGAAATATCCGCCCAAGAAGCCAGGGAAGCAAGGAAAAAGGAAATAGAGGCAAGAAAAGAAGAG
AGGGAGGCAAAGAAAGAAGAAAGGAAAGCGCAGCAGCAGTCTGAGGAAGACAAGCAGGAAAAGAAGCCTGCTGAC
CCTTGGACCTGGGATGCGTCATCTTTGAAGAACATCAAAGTACGTGAAGATGAAATCCCAGAATCGAAGCCAAAA
CGGAAAGTCAGTCGCAAGCAACGCGAGTCCGGTAGGGATGAGGAGGACCTATTTGACGAGGACGAGGAGTCTCAA
CGCCGGAAGCGTCGCGAAGAGAAAAAGCGCTTGAAGAAGGAGAAAGCGCGCAAGAAGGAGATGCAAGCTACTACC
AGCCCTCTCTATCTCCCCGAGTTCATTAGCGTCAGCACTCTTGCAGACGTCATTGGCGTCCGTCCCGCACAGTTT
GTTAGACGCATGGAGGAGATGGGCTTCGACGACGTTACGTATGATCATGTCCTTGATGCAGAAACTGCCGGCCTG
ATTGCCTCTGAATACAACTATGAACCCATTTTCGATACTGGCGAGGGTGACTTGACCGCAGCGCCAGAGCCGGAA
GATAAGTCAAATCTACCTGTCAGGCCCCCGGTCGTGACGATCATGGGGCACGTTGACCACGGTAAAACCACCATC
CTAGACTGGCTTCGCAAGTCCTCGATTGTCGCAACAGAGCACGGAGGTATCACTCAGCACATTGGTGCATTCTCG
GTGGCTATGCCTTCCGGGAAGACCATCACCTTCTTGGATACCCCTGGTCACGCTGCTTTCTTGGATATGCGCCGT
CGTGGTGCGGACGTGACTGACATTGTGGTCCTTGTGGTTGCGGGGGATGACAGCGTCAAACCTCAAACGATTGAG
GCGATTAAGCATGCCACTTCTGCCAATGTCCCTATCATTGTTGCCATGAGCAAGATGGACAAGGAAGGCGTCAAT
CCTGACAGGGTCAAACAGGATCTCTCGATCCACGGTGTACACGTCGAAGATTTTGGTGGTGACGTACAAGCAATC
GGTGTGAGTGGAAAGACCGGCCAGGGAATGCTGGAGCTTGAAGAAGCAATTATCACCTTGTCAGAAGTGCTCGAC
CACCGGGCTGACCCCCAGGGTCACGTCGAAGGATGGGTTATCGAGGCCACTACCAAGAGCTATGGCCGTGTAGCT
ACCGTACTTGTCCGGCGGGGAACGCTACGGACCGGAGATATCATTGTTGCTGGCACCACCTGGGCGCGTGTGCGC
ACACTTCGGAACGAAGCTGGCCAGACAGTTCTCGAAGCCACTCCCGGCATGCCCGTGGAGGTTGATGGCTGGCGA
GAGCAGCCCTCGGCGGGCACTGAGCTTTTGCAGGCTGACGATGAGCAGCACGCTAAGAGTGTCGTGGACTACCGG
TTGGAACGGGCTGAGACACAGAAACTGAGTGAAGACATGACCGCCATCAACGAAGCGCGTCGTGAAAAGCTAGAG
AAACGCCGCCAAGAAGAGGCTGGCGCGGACCAGGCCGAGGAGACCGTACAATCTGGCCCCAAGCCGGTGCAGTTC
ATCATCAAGGCCGACGTTGGTGGCTCGGCAGAGGCCGTTCTCAACTCAGTCACCGCTGTCGGTAACAACGAAGTG
TATGCCAATGTACTTCGCTCTGAAGTAGGCCCGATTAGTGAGTTTGACATTGAGCATGCGGCCACGGCCAATGGC
CACATTATCTCATTCAACATGCCCATCGAGCCTGCGATCTCGCGGATGGCAGAGAAGCGCGGCGTCAATATCATG
AATCACAACATCATCTACAAACTCATTGACGACGTCAAGAGCATTCTGAGTGAGCAGCTGGCACCAAACGTCAGC
CAGCGTGTGACAGGAGAAGCAGAGATCGGACAAATCTTCGAGATCACGGTCAAGGGACGTAACAAGACAGCCATT
GCAGGATGCAAGGTGCGTAATGGAACGATCAATCGGGCCAGGAAGGTTCGCGTAATCCGAGGTCAGGAGACAATC
TACGATGGCTCGATCACGTCTCTAAAGAACGTCAAGAAGGACGTAACGGAGATGCGCAAAGACACGGAATGTGGT
ATCGGCTTCGATGGCTGGACCGACTTTGCCGTTGGCGACCATATCCAATGCTATGAGGAAGTCTTCGAGAAGAGA
TACCTGTAA
Transcript >Ani_SJS100_1|g4111.t1
ATGCACAGGCGGGCTGCTTTGGAACTATCCCGCCGTCACGGTGTCGAATGGTCGTGCGCAACCGCCCGCAGAAAT
GCTGCCTTCGTTCCGGTAGTAGGCTTGGTTCCTCGACGGCATTTTCGAATCTCTCCTCTTCGCCTCGATTCTTCT
GAATCTTCGCCATCGAACAGTCCCGGTGACCCGGTTGCAGGTACAAGCTCCAGCCCTGCACCTTCAGGGCCGAAA
TTCGGTAATCGTTGGGGAAGCAAAACGCAGAGACCGCTTGGGCTGAGTCCGGCGGAGCAAGCCATCCGAGACTCA
TTAGTCGCAAAGAAGCAACAAGAAGAACAACAACAGCGGAAACAAGTACAGAGACAACAGCAAGAGCAGCAACGT
AAAGAAAGGCAGCAGCAATCGCAACAACGATGGAAGGAAGGGCGGTCCCAGGGCCGCATGGAAGAACAATGGCCG
AGCACGAGATGGCGTGATTCCGGCTTCAAGCCCAGGCAATCCGATGCCTTCCCCAGGCGGCGTTCGGGTCATAAC
AATGAGGATAAGGAAAGCCTGTCCCTCCAACCCGACAGATCGCTCGAGGTCAACGTCAACAAGGTGCCCAAGCAC
AAGCGGTCGACAAGTTGGACATGCCCGGACTGTCAGACGAGGTGTTACGGGCAGCATACCGTCTGCCCGCACTGC
AAAGCAGCCAGACCAAACCTGCACGAGGGGCCGCAACGGCACCGAGCCTCACCCCGCCATCGCCACGCAGACGAG
GAAGCCACAAAGATTCGGAAATTGGGCCAGTCTGTCTTGTCTGAGAAGGATGGCGGGAATGCTGAAGGTCTCCGT
CCAAGGGAAGCAGCCTTCAGGGGTTACATGGCAAGCCAAGGACAATTTGCCGGCCCACGGCCTGTGTTCGACTCT
AATGTCGATAAAGAAATATCCGCCCAAGAAGCCAGGGAAGCAAGGAAAAAGGAAATAGAGGCAAGAAAAGAAGAG
AGGGAGGCAAAGAAAGAAGAAAGGAAAGCGCAGCAGCAGTCTGAGGAAGACAAGCAGGAAAAGAAGCCTGCTGAC
CCTTGGACCTGGGATGCGTCATCTTTGAAGAACATCAAAGTACGTGAAGATGAAATCCCAGAATCGAAGCCAAAA
CGGAAAGTCAGTCGCAAGCAACGCGAGTCCGGTAGGGATGAGGAGGACCTATTTGACGAGGACGAGGAGTCTCAA
CGCCGGAAGCGTCGCGAAGAGAAAAAGCGCTTGAAGAAGGAGAAAGCGCGCAAGAAGGAGATGCAAGCTACTACC
AGCCCTCTCTATCTCCCCGAGTTCATTAGCGTCAGCACTCTTGCAGACGTCATTGGCGTCCGTCCCGCACAGTTT
GTTAGACGCATGGAGGAGATGGGCTTCGACGACGTTACGTATGATCATGTCCTTGATGCAGAAACTGCCGGCCTG
ATTGCCTCTGAATACAACTATGAACCCATTTTCGATACTGGCGAGGGTGACTTGACCGCAGCGCCAGAGCCGGAA
GATAAGTCAAATCTACCTGTCAGGCCCCCGGTCGTGACGATCATGGGGCACGTTGACCACGGTAAAACCACCATC
CTAGACTGGCTTCGCAAGTCCTCGATTGTCGCAACAGAGCACGGAGGTATCACTCAGCACATTGGTGCATTCTCG
GTGGCTATGCCTTCCGGGAAGACCATCACCTTCTTGGATACCCCTGGTCACGCTGCTTTCTTGGATATGCGCCGT
CGTGGTGCGGACGTGACTGACATTGTGGTCCTTGTGGTTGCGGGGGATGACAGCGTCAAACCTCAAACGATTGAG
GCGATTAAGCATGCCACTTCTGCCAATGTCCCTATCATTGTTGCCATGAGCAAGATGGACAAGGAAGGCGTCAAT
CCTGACAGGGTCAAACAGGATCTCTCGATCCACGGTGTACACGTCGAAGATTTTGGTGGTGACGTACAAGCAATC
GGTGTGAGTGGAAAGACCGGCCAGGGAATGCTGGAGCTTGAAGAAGCAATTATCACCTTGTCAGAAGTGCTCGAC
CACCGGGCTGACCCCCAGGGTCACGTCGAAGGATGGGTTATCGAGGCCACTACCAAGAGCTATGGCCGTGTAGCT
ACCGTACTTGTCCGGCGGGGAACGCTACGGACCGGAGATATCATTGTTGCTGGCACCACCTGGGCGCGTGTGCGC
ACACTTCGGAACGAAGCTGGCCAGACAGTTCTCGAAGCCACTCCCGGCATGCCCGTGGAGGTTGATGGCTGGCGA
GAGCAGCCCTCGGCGGGCACTGAGCTTTTGCAGGCTGACGATGAGCAGCACGCTAAGAGTGTCGTGGACTACCGG
TTGGAACGGGCTGAGACACAGAAACTGAGTGAAGACATGACCGCCATCAACGAAGCGCGTCGTGAAAAGCTAGAG
AAACGCCGCCAAGAAGAGGCTGGCGCGGACCAGGCCGAGGAGACCGTACAATCTGGCCCCAAGCCGGTGCAGTTC
ATCATCAAGGCCGACGTTGGTGGCTCGGCAGAGGCCGTTCTCAACTCAGTCACCGCTGTCGGTAACAACGAAGTG
TATGCCAATGTACTTCGCTCTGAAGTAGGCCCGATTAGTGAGTTTGACATTGAGCATGCGGCCACGGCCAATGGC
CACATTATCTCATTCAACATGCCCATCGAGCCTGCGATCTCGCGGATGGCAGAGAAGCGCGGCGTCAATATCATG
AATCACAACATCATCTACAAACTCATTGACGACGTCAAGAGCATTCTGAGTGAGCAGCTGGCACCAAACGTCAGC
CAGCGTGTGACAGGAGAAGCAGAGATCGGACAAATCTTCGAGATCACGGTCAAGGGACGTAACAAGACAGCCATT
GCAGGATGCAAGGTGCGTAATGGAACGATCAATCGGGCCAGGAAGGTTCGCGTAATCCGAGGTCAGGAGACAATC
TACGATGGCTCGATCACGTCTCTAAAGAACGTCAAGAAGGACGTAACGGAGATGCGCAAAGACACGGAATGTGGT
ATCGGCTTCGATGGCTGGACCGACTTTGCCGTTGGCGACCATATCCAATGCTATGAGGAAGTCTTCGAGAAGAGA
TACCTGTAA
Gene >Ani_SJS100_1|g4111.t1
ATGCACAGGCGGGCTGCTTTGGAAGTAAGTTTAAATGTCTTCTTATCTGCTAGCTCTGTATCTAACACTCTATCT
TCATTTTCAGCTATCCCGCCGTCACGGTGTCGAATGGTCGTGCGCAACCGCCCGCAGAAATGCTGCCTTCGTTCC
GGTAGTAGGCTTGGTTCCTCGACGGCATTTTCGAATCTCTCCTCTTCGCCTCGATTCTTCTGAATCTTCGCCATC
GAACAGTCCCGGTGACCCGGTTGCAGGTACAAGCTCCAGCCCTGCACCTTCAGGGCCGAAATTCGGTAATCGTTG
GGGAAGCAAAACGCAGAGACCGCTTGGGCTGAGTCCGGCGGAGCAAGCCATCCGAGACTCATTAGTCGCAAAGAA
GCAACAAGAAGAACAACAACAGCGGAAACAAGTACAGAGACAACAGCAAGAGCAGCAACGTAAAGAAAGGCAGCA
GCAATCGCAACAACGATGGAAGGAAGGGCGGTCCCAGGGCCGCATGGAAGAACAATGGCCGAGCACGAGATGGCG
TGATTCCGGCTTCAAGCCCAGGCAATCCGATGCCTTCCCCAGGCGGCGTTCGGGTCATAACAATGAGGATAAGGA
AAGCCTGTCCCTCCAACCCGACAGATCGCTCGAGGTCAACGTCAACAAGGTGCCCAAGCACAAGCGGTCGACAAG
TTGGACATGCCCGGACTGTCAGACGAGGTGTTACGGGCAGCATACCGTCTGCCCGCACTGCAAAGCAGCCAGACC
AAACCTGCACGAGGGGCCGCAACGGCACCGAGCCTCACCCCGCCATCGCCACGCAGACGAGGAAGCCACAAAGAT
TCGGAAATTGGGCCAGTCTGTCTTGTCTGAGAAGGATGGCGGGAATGCTGAAGGTCTCCGTCCAAGGGAAGCAGC
CTTCAGGGGTTACATGGCAAGCCAAGGACAATTTGCCGGCCCACGGCCTGTGTTCGACTCTAATGTCGATAAAGA
AATATCCGCCCAAGAAGCCAGGGAAGCAAGGAAAAAGGAAATAGAGGCAAGAAAAGAAGAGAGGGAGGCAAAGAA
AGAAGAAAGGAAAGCGCAGCAGCAGTCTGAGGAAGACAAGCAGGAAAAGAAGCCTGCTGACCCTTGGACCTGGGA
TGCGTCATCTTTGAAGAACATCAAAGTACGTGAAGATGAAATCCCAGAATCGAAGCCAAAACGGAAAGTCAGTCG
CAAGCAACGCGAGTCCGGTAGGGATGAGGAGGACCTATTTGACGAGGACGAGGAGTCTCAACGCCGGAAGCGTCG
CGAAGAGAAAAAGCGCTTGAAGAAGGAGAAAGCGCGCAAGAAGGAGATGCAAGCTACTACCAGCCCTCTCTATCT
CCCCGAGTTCATTAGCGTCAGCACTCTTGCAGACGTCATTGGCGTCCGTCCCGCACAGTTTGTTAGACGCATGGA
GGAGATGGGCTTCGACGACGTTACGTATGATCATGTCCTTGATGCAGAAACTGCCGGCCTGATTGCCTCTGAATA
CAACTATGAACCCATTTTCGATACTGGCGAGGGTGACTTGACCGCAGCGCCAGAGCCGGAAGATAAGTCAAATCT
ACCTGTCAGGCCCCCGGTCGTGACGATCATGGGGCACGTTGACCACGGTAAAACCACCATCCTAGACTGGCTTCG
CAAGTCCTCGATTGTCGCAACAGAGCACGGAGGTATCACTCAGCACATTGGTGCATTCTCGGTGGCTATGCCTTC
CGGGAAGACCATCACCTTCTTGGATACCCCTGGTCACGCTGCTTTCTTGGATATGCGCCGTCGTGGTGCGGACGT
GACTGACATTGTGGTCCTTGTGGTTGCGGGGGATGACAGCGTCAAACCTCAAACGATTGAGGCGATTAAGCATGC
CACTTCTGCCAATGTCCCTATCATTGTTGCCATGAGCAAGATGGACAAGGAAGGCGTCAATCCTGACAGGGTCAA
ACAGGATCTCTCGATCCACGGTGTACACGTCGAAGATTTTGGTGGTGACGTACAAGCAATCGGTGTGAGTGGAAA
GACCGGCCAGGGAATGCTGGAGCTTGAAGAAGCAATTATCACCTTGTCAGAAGTGCTCGACCACCGGGCTGACCC
CCAGGGTCACGTCGAAGGATGGGTTATCGAGGCCACTACCAAGAGCTATGGCCGTGTAGCTACCGTACTTGTCCG
GCGGGGAACGCTACGGACCGGAGATATCATTGTTGCTGGCACCACCTGGGCGCGTGTGCGCACACTTCGGAACGA
AGCTGGCCAGACAGTTCTCGAAGCCACTCCCGGCATGCCCGTGGAGGTTGATGGCTGGCGAGAGCAGCCCTCGGC
GGGCACTGAGCTTTTGCAGGCTGACGATGAGCAGCACGCTAAGAGTGTCGTGGACTACCGGTTGGAACGGGCTGA
GACACAGAAACTGAGTGAAGACATGACCGCCATCAACGAAGCGCGTCGTGAAAAGCTAGAGAAACGCCGCCAAGA
AGAGGCTGGCGCGGACCAGGCCGAGGAGACCGTACAATCTGGCCCCAAGCCGGTGCAGTTCATCATCAAGGCCGA
CGTTGGTGGCTCGGCAGAGGCCGTTCTCAACTCAGTCACCGCTGTCGGTAACAACGAAGTGTATGCCAATGTACT
TCGCTCTGAAGTAGGCCCGATTAGTGAGTTTGACATTGAGCATGCGGCCACGGCCAATGGCCACATTATCTCATT
CAACATGCCCATCGAGCCTGCGATCTCGCGGATGGCAGAGAAGCGCGGCGTCAATATCATGAATCACAACATCAT
CTACAAACTCATTGACGACGTCAAGAGCATTCTGAGTGAGCAGCTGGCACCAAACGTCAGCCAGCGTGTGACAGG
AGAAGCAGAGATCGGACAAATCTTCGAGATCACGGTCAAGGGACGTAACAAGACAGCCATTGCAGGATGCAAGGT
GCGTAATGGAACGATCAATCGGGCCAGGAAGGTTCGCGTAATCCGAGGTCAGGAGACAATCTACGATGGTAAGTT
GAATCCCTCAATGGCAAGTTGCTTCTATGGCAATGACTAACTGGCTGCAGGCTCGATCACGTCTCTAAAGAACGT
CAAGAAGGACGTAACGGAGATGCGCAAAGACACGGAATGTGGTATCGGCTTCGATGGCTGGACCGACTTTGCCGT
TGGCGACCATATCCAATGCTATGAGGAAGTCTTCGAGAAGAGATACCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail