Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g4044.t1
Gene name
Locationscaffold_019:363032..368288
Strand+
Gene length (bp)5256
Transcript length (bp)4188
Coding sequence length (bp)4188
Protein length (aa) 1396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 4.9E-122 352 904

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005509 calcium ion binding Yes
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0005575 cellular_component No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0004559 alpha-mannosidase activity No
GO:0005488 binding No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0046872 metal ion binding No
GO:0015923 mannosidase activity No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 142 164 22
2 174 196 22
3 315 337 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g4044.t1
MFSPDRSSHVNTSGSIADDQPRRAPNREERFTSWVADHRLDLEQRILGDRAERRESRLPGRPAPSHSSLRDAAAS
QYAPRGPYVPIELQSAAAGSSGEARSHARSERESHSAHSPPDPEDLRCRQSQSFVSRLKEKRLRRRLITLVISAC
FLILVIAIYLAFAASRTTLGRELQILLIFMILILGIVFCHSLTRFLMALLRRPDSDVATNRIPSRAGPAGYAQPA
RPIHVILAGDEDVGAASPNAVREKVTAPPPAYGLWRESVRINPDLLYWQRIENNNAHVPKGVGRHGSNKSRIPRP
PSYTSDNGVDYMSALRSAWIMTWVLLLSLWLAMAQGMRTGQVNELRKETEHMFYHGFENYLEHAFPEDELRPLTC
RPLVRDRENPAHAELNDVLGNYSLTLIDSLSSLAILSSSPDQGQKAWDYFQNGVKDFVTLYGDGSDGPAGQGQRG
RGFDMDSKVQVFETVIRGLGGLLSAHLFAVGDLPITGYNPPETEANFARAWDKHSFPEGSRGIEWKDGFVYDGQL
LRLAVDLANRILPAFYTDTGLPYPRVNLKYGVQRQPYYANSPFNAAPTCDKANPEQCQKPRRSSTFETTETCSAG
AGSLVLEFTVLSRLTGDGRYEELAKRAFWAVWARRSDIGLIGSGIDAESGRWVHSYTGIGAGIDSFFEYAFKSYV
LLSSGERPPANTSSPWHALDDYFLPLSEYEHSADAFLKVWEKSHASIKRHLYRGEGHQHPHLIQGDIFTGATRAF
WIDSLSAFYPGLLTLAGEVDEAIGIHLLTTAVWTRFSGLPERWNVATGDIEQGLSWYGGRPEFVESTYYLYRATK
DPWYLHVGEMVLRDLKRRCWTKCGWAGIQDVRNGELNDRMESFFLGETAKYMFLLYDFDHPLNKLDQPFVFSTEG
HPLIIPKNSTAQRAERKQVPVVVESEGLTCPTAPQPPTLGVSSTAARSDLFHAANLARLHLMPSRGLAEGPLLDY
ARDHPSVSVSDLSSPTNYTFFPWTLPPELVPFNATSAPMTIRPTLDISFPALPGMVVGPGSLERVRDGIFIKAIG
GLRLSMVQDVPVQGESGSAESDEFRVQVINNVPLGKDEKVYLLREITFDVLDPTDPNFTRVRDTAMIDIVIDVIP
EIIRRRNDSDDSHEPAAPRRANGAIVHGSSSVDSKVGSVDASTSSMKTVLSSLVNTLSTLLRDEVQGQTSLPQKK
ATSLRLLLPAAISTGLGSAPLPDVEDATTVSITGDPSKQRLTWNSIYFADELCDNRILREVAQNHQVLVIKRGGC
NFSQKLRNIAAYPPSRYALKLVIVVSYDDEVVEEEQREESDTTTTPGLAAVRAEPYLVRPHLDETQMTAAGVPRR
QLLSVVMVGGGQETYELLRQATGVGIKRRYSVRSQGVPINNLYIL*
Coding >Ani_SJS100_1|g4044.t1
ATGTTCTCGCCCGATCGCTCTTCGCATGTCAATACCAGTGGGTCAATCGCAGATGACCAGCCTCGACGAGCTCCC
AATCGGGAGGAGCGATTCACATCATGGGTAGCCGACCATCGTCTCGACCTGGAACAGCGAATCCTTGGTGACCGC
GCTGAGCGTCGCGAATCGCGTCTACCTGGTCGACCAGCGCCATCGCATAGTTCTCTTAGAGACGCTGCTGCATCT
CAATATGCGCCAAGAGGGCCGTATGTCCCAATTGAGTTGCAGTCCGCAGCAGCAGGAAGCTCCGGCGAAGCGCGG
TCGCATGCGCGCTCAGAACGAGAATCGCATTCAGCACACTCCCCGCCTGACCCTGAAGACCTCCGATGCAGGCAA
TCGCAATCGTTCGTATCACGGCTGAAGGAGAAGAGGCTACGGAGGCGACTGATTACGCTGGTTATATCTGCATGT
TTTCTCATCCTCGTTATCGCCATTTACCTCGCATTCGCTGCTTCCCGTACGACATTGGGCCGAGAGCTCCAAATA
CTTCTCATCTTCATGATCTTAATTCTTGGCATTGTTTTCTGTCATTCTCTCACGCGCTTCTTGATGGCACTATTA
CGACGGCCTGACTCTGATGTCGCTACGAATCGCATACCCAGTAGGGCAGGGCCAGCCGGCTATGCGCAACCAGCG
CGTCCCATCCACGTTATTCTAGCTGGAGATGAGGACGTTGGAGCCGCGAGTCCGAATGCCGTGCGCGAAAAGGTC
ACGGCGCCTCCTCCGGCATACGGTCTTTGGCGAGAAAGTGTGAGGATTAACCCCGACTTGTTGTACTGGCAGCGC
ATCGAAAATAACAATGCGCACGTACCCAAGGGTGTTGGCAGGCATGGGAGCAATAAATCGCGGATCCCACGGCCG
CCTAGCTACACCTCTGACAACGGCGTCGACTATATGTCCGCCCTCCGTTCAGCATGGATCATGACCTGGGTCTTG
CTGCTGTCGCTGTGGCTCGCCATGGCCCAGGGCATGCGGACCGGTCAGGTTAACGAACTCAGGAAGGAGACAGAG
CATATGTTCTACCACGGATTCGAAAACTATCTCGAACACGCCTTTCCTGAAGACGAACTCCGTCCTTTAACATGC
CGTCCGCTGGTTCGCGACCGAGAGAATCCCGCGCATGCAGAGCTCAACGATGTCCTGGGTAATTATTCATTGACT
CTGATCGACAGTCTGTCCTCCCTGGCAATACTTTCGTCGAGTCCCGACCAGGGCCAGAAGGCTTGGGATTACTTC
CAGAATGGAGTGAAGGATTTTGTTACACTGTACGGCGATGGATCCGATGGCCCCGCGGGCCAGGGTCAGAGGGGA
CGAGGATTCGATATGGATAGTAAAGTGCAAGTGTTCGAGACGGTGATTCGAGGGTTAGGTGGCCTACTCAGCGCT
CATCTTTTTGCTGTGGGCGATCTTCCTATCACCGGATACAATCCGCCGGAGACCGAAGCCAACTTCGCCAGAGCC
TGGGATAAGCACTCCTTCCCTGAAGGCAGTCGCGGCATCGAGTGGAAGGACGGATTCGTCTACGATGGCCAACTT
CTACGGCTTGCTGTCGATCTTGCAAATCGAATTTTACCCGCGTTCTATACGGACACTGGACTCCCTTACCCTCGA
GTGAACTTGAAGTACGGGGTGCAACGGCAGCCGTACTACGCAAACTCACCGTTTAATGCAGCCCCTACGTGTGAT
AAAGCCAATCCTGAACAGTGCCAAAAGCCTCGCCGCTCCTCGACCTTTGAGACTACGGAAACCTGCAGCGCTGGC
GCTGGCAGTCTAGTCCTCGAGTTTACAGTTTTGAGCAGACTTACAGGCGATGGACGATATGAGGAGCTTGCCAAG
CGAGCATTCTGGGCCGTTTGGGCAAGGAGGAGTGATATTGGACTGATTGGGTCCGGTATTGATGCCGAGTCAGGT
AGATGGGTTCATTCCTATACCGGGATCGGCGCAGGAATTGATAGCTTTTTCGAGTATGCTTTCAAGTCCTACGTA
CTACTCTCGTCAGGGGAACGGCCCCCGGCCAATACTAGCAGCCCGTGGCATGCCCTGGACGACTATTTCCTACCA
CTTTCAGAATACGAGCACTCCGCCGATGCCTTTCTGAAGGTCTGGGAGAAGTCTCATGCCTCAATAAAACGTCAC
CTATACCGCGGAGAGGGCCATCAGCACCCGCATCTGATCCAGGGAGACATCTTCACCGGAGCGACTCGTGCTTTT
TGGATCGACAGTCTTAGCGCCTTCTACCCCGGACTTCTTACTTTAGCGGGAGAAGTGGATGAAGCCATTGGCATC
CATCTTCTGACGACGGCAGTCTGGACTCGATTTTCCGGTCTTCCTGAGCGATGGAATGTTGCCACCGGGGACATT
GAACAGGGCCTTTCCTGGTATGGTGGCCGCCCTGAGTTCGTGGAATCTACTTACTACCTCTACCGAGCGACAAAG
GACCCCTGGTATCTGCATGTCGGAGAGATGGTACTGCGGGATTTGAAACGGCGATGCTGGACCAAGTGCGGTTGG
GCTGGTATTCAGGACGTTCGGAATGGCGAGCTCAATGACCGCATGGAGAGCTTCTTCCTGGGTGAAACTGCCAAG
TACATGTTTCTGCTGTACGATTTTGATCATCCCCTCAATAAGCTAGACCAGCCGTTCGTCTTCTCCACCGAGGGC
CACCCTCTAATTATCCCCAAGAACAGCACGGCACAGCGCGCTGAGCGCAAGCAGGTACCAGTCGTTGTGGAGAGC
GAGGGTTTGACATGCCCAACAGCACCTCAGCCTCCAACGCTGGGGGTTTCATCCACTGCGGCACGGTCCGATCTG
TTCCACGCCGCGAACCTGGCACGCCTACACCTCATGCCGAGTAGAGGTCTAGCGGAAGGCCCTCTTCTGGATTAC
GCTCGGGACCACCCGAGCGTATCAGTGTCGGACTTGTCGTCGCCCACCAACTACACATTCTTCCCATGGACATTG
CCTCCAGAGCTTGTGCCATTTAACGCAACCAGCGCGCCGATGACAATCCGTCCTACGCTCGACATTTCTTTCCCC
GCGCTTCCCGGTATGGTCGTGGGGCCTGGATCACTGGAACGAGTGCGGGATGGCATCTTTATCAAAGCCATCGGG
GGCCTACGACTAAGTATGGTTCAGGATGTCCCTGTGCAAGGGGAATCCGGGAGCGCAGAGAGTGATGAATTCCGG
GTCCAGGTTATCAACAACGTGCCACTGGGCAAAGACGAGAAGGTATATCTTCTACGGGAAATCACATTTGATGTC
CTCGACCCCACCGACCCGAATTTCACGCGGGTTCGCGACACCGCCATGATTGACATCGTCATTGACGTTATCCCA
GAGATTATCCGTCGACGAAATGATTCAGATGATAGTCATGAACCAGCTGCGCCTCGACGTGCCAACGGAGCCATC
GTCCATGGCTCCAGCTCCGTCGACAGTAAAGTCGGCAGCGTAGATGCGTCGACCTCCAGCATGAAGACTGTGCTC
TCCTCGCTAGTCAACACTCTATCTACACTCCTTCGGGATGAAGTACAGGGCCAGACCAGCCTGCCGCAGAAGAAA
GCCACCTCGTTACGTCTCCTGCTCCCGGCCGCCATCTCCACGGGGCTCGGCTCGGCCCCGCTCCCCGACGTGGAA
GACGCCACGACAGTCTCCATCACGGGCGACCCTTCCAAGCAACGCCTCACATGGAACAGCATCTACTTCGCGGAC
GAGCTCTGCGACAACCGCATCCTACGAGAAGTTGCACAGAACCACCAGGTCCTCGTAATCAAGCGAGGCGGATGC
AACTTTTCGCAGAAGCTGCGCAACATTGCCGCGTATCCGCCTTCTCGGTACGCCCTGAAACTAGTCATCGTGGTC
TCCTACGACGATGAAGTAGTCGAGGAGGAGCAGCGCGAGGAATCAGACACCACCACGACCCCGGGGCTAGCTGCG
GTCCGCGCGGAACCTTATCTGGTGCGGCCCCATCTGGACGAGACGCAAATGACAGCCGCGGGCGTCCCGCGGCGC
CAGCTGCTCAGCGTAGTCATGGTAGGCGGAGGGCAAGAAACATACGAGCTACTGCGACAAGCCACGGGGGTGGGC
ATTAAACGGCGATATTCGGTGCGATCGCAGGGAGTTCCCATCAACAATCTGTATATTTTGTGA
Transcript >Ani_SJS100_1|g4044.t1
ATGTTCTCGCCCGATCGCTCTTCGCATGTCAATACCAGTGGGTCAATCGCAGATGACCAGCCTCGACGAGCTCCC
AATCGGGAGGAGCGATTCACATCATGGGTAGCCGACCATCGTCTCGACCTGGAACAGCGAATCCTTGGTGACCGC
GCTGAGCGTCGCGAATCGCGTCTACCTGGTCGACCAGCGCCATCGCATAGTTCTCTTAGAGACGCTGCTGCATCT
CAATATGCGCCAAGAGGGCCGTATGTCCCAATTGAGTTGCAGTCCGCAGCAGCAGGAAGCTCCGGCGAAGCGCGG
TCGCATGCGCGCTCAGAACGAGAATCGCATTCAGCACACTCCCCGCCTGACCCTGAAGACCTCCGATGCAGGCAA
TCGCAATCGTTCGTATCACGGCTGAAGGAGAAGAGGCTACGGAGGCGACTGATTACGCTGGTTATATCTGCATGT
TTTCTCATCCTCGTTATCGCCATTTACCTCGCATTCGCTGCTTCCCGTACGACATTGGGCCGAGAGCTCCAAATA
CTTCTCATCTTCATGATCTTAATTCTTGGCATTGTTTTCTGTCATTCTCTCACGCGCTTCTTGATGGCACTATTA
CGACGGCCTGACTCTGATGTCGCTACGAATCGCATACCCAGTAGGGCAGGGCCAGCCGGCTATGCGCAACCAGCG
CGTCCCATCCACGTTATTCTAGCTGGAGATGAGGACGTTGGAGCCGCGAGTCCGAATGCCGTGCGCGAAAAGGTC
ACGGCGCCTCCTCCGGCATACGGTCTTTGGCGAGAAAGTGTGAGGATTAACCCCGACTTGTTGTACTGGCAGCGC
ATCGAAAATAACAATGCGCACGTACCCAAGGGTGTTGGCAGGCATGGGAGCAATAAATCGCGGATCCCACGGCCG
CCTAGCTACACCTCTGACAACGGCGTCGACTATATGTCCGCCCTCCGTTCAGCATGGATCATGACCTGGGTCTTG
CTGCTGTCGCTGTGGCTCGCCATGGCCCAGGGCATGCGGACCGGTCAGGTTAACGAACTCAGGAAGGAGACAGAG
CATATGTTCTACCACGGATTCGAAAACTATCTCGAACACGCCTTTCCTGAAGACGAACTCCGTCCTTTAACATGC
CGTCCGCTGGTTCGCGACCGAGAGAATCCCGCGCATGCAGAGCTCAACGATGTCCTGGGTAATTATTCATTGACT
CTGATCGACAGTCTGTCCTCCCTGGCAATACTTTCGTCGAGTCCCGACCAGGGCCAGAAGGCTTGGGATTACTTC
CAGAATGGAGTGAAGGATTTTGTTACACTGTACGGCGATGGATCCGATGGCCCCGCGGGCCAGGGTCAGAGGGGA
CGAGGATTCGATATGGATAGTAAAGTGCAAGTGTTCGAGACGGTGATTCGAGGGTTAGGTGGCCTACTCAGCGCT
CATCTTTTTGCTGTGGGCGATCTTCCTATCACCGGATACAATCCGCCGGAGACCGAAGCCAACTTCGCCAGAGCC
TGGGATAAGCACTCCTTCCCTGAAGGCAGTCGCGGCATCGAGTGGAAGGACGGATTCGTCTACGATGGCCAACTT
CTACGGCTTGCTGTCGATCTTGCAAATCGAATTTTACCCGCGTTCTATACGGACACTGGACTCCCTTACCCTCGA
GTGAACTTGAAGTACGGGGTGCAACGGCAGCCGTACTACGCAAACTCACCGTTTAATGCAGCCCCTACGTGTGAT
AAAGCCAATCCTGAACAGTGCCAAAAGCCTCGCCGCTCCTCGACCTTTGAGACTACGGAAACCTGCAGCGCTGGC
GCTGGCAGTCTAGTCCTCGAGTTTACAGTTTTGAGCAGACTTACAGGCGATGGACGATATGAGGAGCTTGCCAAG
CGAGCATTCTGGGCCGTTTGGGCAAGGAGGAGTGATATTGGACTGATTGGGTCCGGTATTGATGCCGAGTCAGGT
AGATGGGTTCATTCCTATACCGGGATCGGCGCAGGAATTGATAGCTTTTTCGAGTATGCTTTCAAGTCCTACGTA
CTACTCTCGTCAGGGGAACGGCCCCCGGCCAATACTAGCAGCCCGTGGCATGCCCTGGACGACTATTTCCTACCA
CTTTCAGAATACGAGCACTCCGCCGATGCCTTTCTGAAGGTCTGGGAGAAGTCTCATGCCTCAATAAAACGTCAC
CTATACCGCGGAGAGGGCCATCAGCACCCGCATCTGATCCAGGGAGACATCTTCACCGGAGCGACTCGTGCTTTT
TGGATCGACAGTCTTAGCGCCTTCTACCCCGGACTTCTTACTTTAGCGGGAGAAGTGGATGAAGCCATTGGCATC
CATCTTCTGACGACGGCAGTCTGGACTCGATTTTCCGGTCTTCCTGAGCGATGGAATGTTGCCACCGGGGACATT
GAACAGGGCCTTTCCTGGTATGGTGGCCGCCCTGAGTTCGTGGAATCTACTTACTACCTCTACCGAGCGACAAAG
GACCCCTGGTATCTGCATGTCGGAGAGATGGTACTGCGGGATTTGAAACGGCGATGCTGGACCAAGTGCGGTTGG
GCTGGTATTCAGGACGTTCGGAATGGCGAGCTCAATGACCGCATGGAGAGCTTCTTCCTGGGTGAAACTGCCAAG
TACATGTTTCTGCTGTACGATTTTGATCATCCCCTCAATAAGCTAGACCAGCCGTTCGTCTTCTCCACCGAGGGC
CACCCTCTAATTATCCCCAAGAACAGCACGGCACAGCGCGCTGAGCGCAAGCAGGTACCAGTCGTTGTGGAGAGC
GAGGGTTTGACATGCCCAACAGCACCTCAGCCTCCAACGCTGGGGGTTTCATCCACTGCGGCACGGTCCGATCTG
TTCCACGCCGCGAACCTGGCACGCCTACACCTCATGCCGAGTAGAGGTCTAGCGGAAGGCCCTCTTCTGGATTAC
GCTCGGGACCACCCGAGCGTATCAGTGTCGGACTTGTCGTCGCCCACCAACTACACATTCTTCCCATGGACATTG
CCTCCAGAGCTTGTGCCATTTAACGCAACCAGCGCGCCGATGACAATCCGTCCTACGCTCGACATTTCTTTCCCC
GCGCTTCCCGGTATGGTCGTGGGGCCTGGATCACTGGAACGAGTGCGGGATGGCATCTTTATCAAAGCCATCGGG
GGCCTACGACTAAGTATGGTTCAGGATGTCCCTGTGCAAGGGGAATCCGGGAGCGCAGAGAGTGATGAATTCCGG
GTCCAGGTTATCAACAACGTGCCACTGGGCAAAGACGAGAAGGTATATCTTCTACGGGAAATCACATTTGATGTC
CTCGACCCCACCGACCCGAATTTCACGCGGGTTCGCGACACCGCCATGATTGACATCGTCATTGACGTTATCCCA
GAGATTATCCGTCGACGAAATGATTCAGATGATAGTCATGAACCAGCTGCGCCTCGACGTGCCAACGGAGCCATC
GTCCATGGCTCCAGCTCCGTCGACAGTAAAGTCGGCAGCGTAGATGCGTCGACCTCCAGCATGAAGACTGTGCTC
TCCTCGCTAGTCAACACTCTATCTACACTCCTTCGGGATGAAGTACAGGGCCAGACCAGCCTGCCGCAGAAGAAA
GCCACCTCGTTACGTCTCCTGCTCCCGGCCGCCATCTCCACGGGGCTCGGCTCGGCCCCGCTCCCCGACGTGGAA
GACGCCACGACAGTCTCCATCACGGGCGACCCTTCCAAGCAACGCCTCACATGGAACAGCATCTACTTCGCGGAC
GAGCTCTGCGACAACCGCATCCTACGAGAAGTTGCACAGAACCACCAGGTCCTCGTAATCAAGCGAGGCGGATGC
AACTTTTCGCAGAAGCTGCGCAACATTGCCGCGTATCCGCCTTCTCGGTACGCCCTGAAACTAGTCATCGTGGTC
TCCTACGACGATGAAGTAGTCGAGGAGGAGCAGCGCGAGGAATCAGACACCACCACGACCCCGGGGCTAGCTGCG
GTCCGCGCGGAACCTTATCTGGTGCGGCCCCATCTGGACGAGACGCAAATGACAGCCGCGGGCGTCCCGCGGCGC
CAGCTGCTCAGCGTAGTCATGGTAGGCGGAGGGCAAGAAACATACGAGCTACTGCGACAAGCCACGGGGGTGGGC
ATTAAACGGCGATATTCGGTGCGATCGCAGGGAGTTCCCATCAACAATCTGTATATTTTGTGA
Gene >Ani_SJS100_1|g4044.t1
ATGTTCTCGCCCGATCGCTCTTCGCATGTCAATACCAGTGGGTCAATCGCAGATGACCAGCCTCGACGAGCTCCC
AATCGGGAGGAGCGATTCACATCATGGGTAGCCGACCATCGTCTCGACCTGGAACAGCGAATCCTTGGTGACCGC
GCTGAGCGTCGCGAATCGCGTCTACCTGGTCGACCAGCGCCATCGCATAGTTCTCTTAGAGACGCTGCTGCATCT
CAATATGCGCCAAGAGGGCCGTATGTCCCAATTGAGTTGCAGTCCGCAGCAGCAGGAAGCTCCGGCGAAGCGCGG
TCGCATGCGCGCTCAGAACGAGAATCGCATTCAGCACACTCCCCGCCTGACCCTGAAGACCTCCGATGCAGGCAA
TCGCAATCGTTCGTATCACGGCTGAAGGAGAAGAGGCTACGGAGGCGACTGATTACGCTGGTTATATCTGCATGT
TTTCTCATCCTCGTTATCGCCATTTACCTCGCATTCGCTGCTTCCCGTACGACATTGGGCCGAGAGCTCCAAATA
CTTCTCATCTTCATGATCTTAATTCTTGGCATTGTTTTCTGTCATTCTCTCACGCGCTTCTTGATGGCACTATTA
CGACGGCCTGACTCTGATGTCGCTACGAATCGCATACCCAGTAGGGCAGGGCCAGCCGGCTATGCGCAACCAGCG
CGTCCCATCCACGTTATTCTAGCTGGAGATGAGGACGTTGGAGCCGCGAGTCCGAATGCCGTGCGCGAAAAGGTC
ACGGCGCCTCCTCCGGCATACGGTCTTTGGCGAGAAAGTGTGGTAAGTACATGATTACAGGAATGGCGTTATTTC
CTTGATGGTGACCAGTCCCGCTAACTTTGTGCAGAGGATTAACCCCGACTTGTTGTACTGGCAGCGCATCGAAAA
TAACAATGCGCACGTACCCAAGGGTGTTGGCAGGCATGGGAGCAATAAATCGCGGATCCCACGGCCGCCTAGCTA
CACCTCTGACAACGGCGTCGACTATGTGATAGAAGCGCAACCCCGATCATTCACCCAATGGCGGATTCCTGAAGA
ATCAGGGCATCAGCCATGACCCATACATATCTCTCTCTCTTTTCTCGACATACTGAAGCTGGATTCACCGACACA
ATGACATCCACAATCGTCTCGTTATCCGCAAAATCATTTATATAGCGGTACTGTGATCACCTTCATCTGTATTTC
TTTTGCTCGAGATATCCCCTGTGACTTGGCTTCTTTCCCTTTTTTTTCACCCTTTTGCGGCATTCTCATCACCAA
TCATGTGATGTTTCTTTGTTTTCTTTTGTACCTGAAAATTCTTGGATGAAGCGGGAGTTACATTGGCATACACAC
TGATCTTCCTGGCGAGCATTTGTTTGAGCGCTATTTCATTAAGCTTGGTTTTCTAACTTACTGCAAAGTACATCT
TAACCCTTCTAAATGTTAAAGTATCTGGGAAACGAGGCCTACCGTAAGCAAGCCGATTCGTCAAAAATCCTGTAT
TAATAATATAAACATCCCCTAAAATTGAATTAAGGGATCCTGTAGTCCGAAGGGAAGGGGGAGTGGAGGGAGAAT
GTAAACGGCATATCTGGCCGCAAATTGGTTCGCCGCGGATTGAATACGACCTCACGTGCGGCGCCGCTGCCACCA
CCAACTTCCCCTCAAGCCTCCCCCCTCAGGAACCCTTCTCTGGAGGCAGTTCAGTTCGCCGGTCTGCGGGGTTTT
CACATTGAACAGTTCATCAACGCGCTCCCATGCCATTGATAACTGTTTCGCTACTGCGGTAATGCGCTCGGGATG
TTGGCACTCGCAGATGTCCGCCCTCCGTTCAGCATGGATCATGACCTGGGTCTTGCTGCTGTCGCTGTGGCTCGC
CATGGCCCAGGGCATGCGGACCGGTCAGGTTAACGAACTCAGGTAAATCTCACCAGTCATTACCTGATTCCCGGT
TTCGCTGGTATAGGGGCCGATCGACTGACACCCTCGATATTTAGGAAGGAGACAGAGCATATGTTCTACCACGGA
TTCGAAAACTATCTCGAACACGCCTTTCCTGAAGACGAACTCCGTCCTTTAACATGCCGTCCGCTGGTTCGCGAC
CGAGAGAATCCCGCGCATGCAGAGCTCAACGATGTCCTGGGTAATTATTCATTGACTCTGATCGACAGTCTGTCC
TCCCTGGCAATACTTTCGTCGAGTCCCGACCAGGGCCAGAAGGCTTGGGATTACTTCCAGAATGGAGTGAAGGAT
TTTGTTACACTGTACGGCGATGGATCCGATGGCCCCGCGGGCCAGGGTCAGAGGGGACGAGGATTCGATATGGAT
AGTAAAGTGCAAGTGTTCGAGACGGTGATTCGAGGGTTAGGTAGGCATCGGATCTTGTGCATGGGGAGTATGCAT
CTCGATTAATGGTTTTCTCTAGGTGGCCTACTCAGCGCTCATCTTTTTGCTGTGGGCGATCTTCCTATCACCGGA
TACAATCCGCCGGAGACCGAAGCCAACTTCGCCAGAGCCTGGGATAAGCACTCCTTCCCTGAAGGCAGTCGCGGC
ATCGAGTGGAAGGACGGATTCGTCTACGATGGCCAACTTCTACGGCTTGCTGTCGATCTTGCAAATCGAATTTTA
CCCGCGTTCTATACGGACACTGGACTCCCTTACCCTCGAGTGAACTTGAAGTACGGGGTGCAACGGCAGCCGTAC
TACGCAAACTCACCGTTTAATGCAGCCCCTACGTGTGATAAAGCCAATCCTGAACAGTGCCAAAAGCCTCGCCGC
TCCTCGACCTTTGAGACTACGGAAACCTGCAGCGCTGGCGCTGGCAGTCTAGTCCTCGAGTTTACAGTTTTGAGC
AGACTTACAGGCGATGGACGATATGAGGAGCTTGCCAAGCGAGCATTCTGGGCCGTTTGGGCAAGGAGGAGTGAT
ATTGGACTGATTGGGTCCGGTATTGATGCCGAGTCAGGTAGATGGGTTCATTCCTATACCGGGGTGAGTCAAATC
AAGCACGTGCATTTGAATATGGCTAACACTACCACGTCCCAGATCGGCGCAGGAATTGATAGCTTTTTCGAGTAT
GCTTTCAAGTCCTACGTACTACTCTCGTCAGGGGAACGGCCCCCGGCCAATACTAGCAGCCCGTGGCATGCCCTG
GACGACTATTTCCTACCACTTTCAGAATACGAGCACTCCGCCGATGCCTTTCTGAAGGTCTGGGAGAAGTCTCAT
GCCTCAATAAAACGTCACCTATACCGCGGAGAGGGCCATCAGCACCCGCATCTGATCCAGGGAGACATCTTCACC
GGAGCGACTCGTGCTTTTTGGATCGACAGTCTTAGCGCCTTCTACCCCGGACTTCTTACTTTAGCGGGAGAAGTG
GATGAAGCCATTGGCATCCATCTTCTGACGACGGCAGTCTGGACTCGATTTTCCGGTCTTCCTGAGCGATGGAAT
GTTGCCACCGGGGACATTGAACAGGGCCTTTCCTGGTATGGTGGCCGCCCTGAGTTCGTGGAATCTACTTACTAC
CTCTACCGAGCGACAAAGGACCCCTGGTATCTGCATGTCGGAGAGATGGTACTGCGGGATTTGAAACGGCGATGC
TGGACCAAGTGCGGTTGGGCTGGTATTCAGGACGTTCGGAATGGCGAGCTCAATGACCGCATGGAGAGCTTCTTC
CTGGGTGAAACTGCCAAGTACATGTTTCTGCTGTACGATTTTGATCATCCCCTCAATAAGCTAGACCAGCCGTTC
GTCTTCTCCACCGAGGGCCACCCTCTAATTATCCCCAAGAACAGCACGGCACAGCGCGCTGAGCGCAAGCAGGTA
CCAGTCGTTGTGGAGAGCGAGGGTTTGACATGCCCAACAGCACCTCAGCCTCCAACGCTGGGGGTTTCATCCACT
GCGGCACGGTCCGATCTGTTCCACGCCGCGAACCTGGCACGCCTACACCTCATGCCGAGTAGAGGTCTAGCGGAA
GGCCCTCTTCTGGATTACGCTCGGGACCACCCGAGCGTATCAGTGTCGGACTTGTCGTCGCCCACCAACTACACA
TTCTTCCCATGGACATTGCCTCCAGAGCTTGTGCCATTTAACGCAACCAGCGCGCCGATGACAATCCGTCCTACG
CTCGACATTTCTTTCCCCGCGCTTCCCGGTATGGTCGTGGGGCCTGGATCACTGGAACGAGTGCGGGATGGCATC
TTTATCAAAGCCATCGGGGGCCTACGACTAAGTATGGTTCAGGATGTCCCTGTGCAAGGGGAATCCGGGAGCGCA
GAGAGTGATGAATTCCGGGTCCAGGTTATCAACAACGTGCCACTGGGCAAAGACGAGAAGGTATATCTTCTACGG
GAAATCACATTTGATGTCCTCGACCCCACCGACCCGAATTTCACGCGGGTTCGCGACACCGCCATGATTGACATC
GTCATTGACGTTATCCCAGAGATTATCCGTCGACGAAATGATTCAGATGATAGTCATGAACCAGCTGCGCCTCGA
CGTGCCAACGGAGCCATCGTCCATGGCTCCAGCTCCGTCGACAGTAAAGTCGGCAGCGTAGATGCGTCGACCTCC
AGCATGAAGACTGTGCTCTCCTCGCTAGTCAACACTCTATCTACACTCCTTCGGGATGAAGTACAGGGCCAGACC
AGCCTGCCGCAGAAGAAAGCCACCTCGTTACGTCTCCTGCTCCCGGCCGCCATCTCCACGGGGCTCGGCTCGGCC
CCGCTCCCCGACGTGGAAGACGCCACGACAGTCTCCATCACGGGCGACCCTTCCAAGCAACGCCTCACATGGAAC
AGCATCTACTTCGCGGACGAGCTCTGCGACAACCGCATCCTACGAGAAGTTGCACAGAACCACCAGGTCCTCGTA
ATCAAGCGAGGCGGATGCAACTTTTCGCAGAAGCTGCGCAACATTGCCGCGTATCCGCCTTCTCGGTACGCCCTG
AAACTAGTCATCGTGGTCTCCTACGACGATGAAGTAGTCGAGGAGGAGCAGCGCGAGGAATCAGACACCACCACG
ACCCCGGGGCTAGCTGCGGTCCGCGCGGAACCTTATCTGGTGCGGCCCCATCTGGACGAGACGCAAATGACAGCC
GCGGGCGTCCCGCGGCGCCAGCTGCTCAGCGTAGTCATGGTAGGCGGAGGGCAAGAAACATACGAGCTACTGCGA
CAAGCCACGGGGGTGGGCATTAAACGGCGATATTCGGTGCGATCGCAGGGAGTTCCCATCAACAATCTGTATATT
TTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail