Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3930.t1
Gene name
Locationscaffold_018:453778..454529
Strand+
Gene length (bp)751
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 7.9E-08 63 188
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 2.1E-06 133 190
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.7E-05 138 193

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016407 acetyltransferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3930.t1
MTFTIRYATEEDAPHLANINVVSFNHQAFWAALFPNVAVPGTLPLKTARCLDKLRSPQVHVVAAVDDDSGKIIGY
SRWLFPKDYETSVVDLSSEGVDALAAHEDGKAYPEGINMGIYQAFKDLLAEMHRLHFEEGDIMLEFLATLPEAQG
KGVGTALLQWGIERADAMNARVYLEATEDGYPLYWKHGWRDLQVARLDFTEYGSTGSQEWVVMRRDRRVPVAE*
Coding >Ani_SJS100_1|g3930.t1
ATGACCTTCACAATCCGCTACGCCACGGAGGAAGATGCTCCCCACCTTGCCAACATCAACGTAGTCAGCTTCAAT
CACCAGGCATTCTGGGCCGCGCTCTTCCCAAACGTCGCCGTGCCCGGAACTTTGCCCCTCAAAACAGCCCGTTGT
CTAGATAAGCTCAGGTCGCCGCAAGTGCATGTCGTGGCCGCGGTTGATGATGACTCGGGCAAAATCATCGGATAT
TCTCGATGGCTGTTTCCGAAGGATTACGAAACGAGCGTTGTCGATTTGTCCTCCGAGGGCGTAGATGCACTAGCG
GCTCATGAAGACGGGAAAGCGTACCCTGAGGGTATCAACATGGGAATCTATCAAGCATTTAAGGACCTTTTGGCT
GAGATGCACCGGTTACATTTTGAGGAGGGGGATATCATGCTGGAATTCCTCGCTACCTTGCCGGAAGCTCAAGGC
AAGGGTGTCGGAACGGCTTTGCTGCAATGGGGCATTGAGCGTGCTGATGCGATGAATGCTAGAGTGTATTTGGAG
GCCACCGAGGATGGTTATCCGCTTTACTGGAAGCATGGATGGCGGGATTTGCAGGTGGCGAGGCTGGACTTTACG
GAGTATGGGAGCACAGGGTCACAGGAGTGGGTTGTTATGCGGAGGGATAGGAGGGTGCCGGTTGCTGAATGA
Transcript >Ani_SJS100_1|g3930.t1
ATGACCTTCACAATCCGCTACGCCACGGAGGAAGATGCTCCCCACCTTGCCAACATCAACGTAGTCAGCTTCAAT
CACCAGGCATTCTGGGCCGCGCTCTTCCCAAACGTCGCCGTGCCCGGAACTTTGCCCCTCAAAACAGCCCGTTGT
CTAGATAAGCTCAGGTCGCCGCAAGTGCATGTCGTGGCCGCGGTTGATGATGACTCGGGCAAAATCATCGGATAT
TCTCGATGGCTGTTTCCGAAGGATTACGAAACGAGCGTTGTCGATTTGTCCTCCGAGGGCGTAGATGCACTAGCG
GCTCATGAAGACGGGAAAGCGTACCCTGAGGGTATCAACATGGGAATCTATCAAGCATTTAAGGACCTTTTGGCT
GAGATGCACCGGTTACATTTTGAGGAGGGGGATATCATGCTGGAATTCCTCGCTACCTTGCCGGAAGCTCAAGGC
AAGGGTGTCGGAACGGCTTTGCTGCAATGGGGCATTGAGCGTGCTGATGCGATGAATGCTAGAGTGTATTTGGAG
GCCACCGAGGATGGTTATCCGCTTTACTGGAAGCATGGATGGCGGGATTTGCAGGTGGCGAGGCTGGACTTTACG
GAGTATGGGAGCACAGGGTCACAGGAGTGGGTTGTTATGCGGAGGGATAGGAGGGTGCCGGTTGCTGAATGA
Gene >Ani_SJS100_1|g3930.t1
ATGACCTTCACAATCCGCTACGCCACGGAGGAAGATGCTCCCCACCTTGCCAACATCAACGTAGTCAGCTTCAAT
CACCAGGCATTCTGGGCCGCGCTCTTCCCAAACGTCGCCGTGCCCGGAACTTTGCCCCTCAAAACAGCCCGTTGT
CTAGATAAGCTCAGGTCGCCGCAAGTGCATGTCGTGGCCGCGGTTGATGATGACTCGGGCAAAATCATCGGATAT
TCTCGATGGCTGTTTCCGAAGGATTACGAAACGAGCGTTGTCGATTTGTCCTCCGAGGGCGTAGATGCACTAGCG
GCTCATGAAGACGGGAAAGCGTACCCTGAGGGTATCAACATGGGAATCTATCAAGCATTTAAGGACCTTTTGGCT
GAGATGCACCGGTTACATTTTGAGGAGGGGGATATCAGTATGTTTATACCTGCTCTTATATTTTTCTCATTCTAG
TACTTGGAAGATTTGCTGTATGTATGTACTGACTACAGTAGTGCTGGAATTCCTCGCTACCTTGCCGGAAGCTCA
AGGCAAGGGTGTCGGAACGGCTTTGCTGCAATGGGGCATTGAGCGTGCTGATGCGATGAATGCTAGAGTGTATTT
GGAGGCCACCGAGGATGGTTATCCGCTTTACTGGAAGCATGGATGGCGGGATTTGCAGGTGGCGAGGCTGGACTT
TACGGAGTATGGGAGCACAGGGTCACAGGAGTGGGTTGTTATGCGGAGGGATAGGAGGGTGCCGGTTGCTGAATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail