Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3926.t1
Gene name
Locationscaffold_018:442508..444230
Strand-
Gene length (bp)1722
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.8E-12 171 242
PF13637 Ank_4 Ankyrin repeats (many copies) 1.6E-05 183 225
PF13637 Ank_4 Ankyrin repeats (many copies) 9.4E-06 213 252
PF00023 Ank Ankyrin repeat 1.4E-04 178 210
PF00023 Ank Ankyrin repeat 1.5E-03 211 243
PF13606 Ank_3 Ankyrin repeat 3.2E-04 211 240
PF13857 Ank_5 Ankyrin repeats (many copies) 1.3E-08 198 246

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3926.t1
MERPSPEADVIWWDSSSYYVRCPFCEGVHRHTVNWQTGLFRVSDCEKGETYQSCFPINDQGEVAYEIDKKRGRYV
NICVSNDSDTEADDNEDEDDVDRLATEMAHKATIAAEREERHLSITRDAKENIIHTIDGEKYFEYRLIYDAITDC
FNGKTRAVQGYLKTSSETELFVRGQFPDGKTMLISAASEKTPEMLSLLIEHGADVNAVDNHGRSALMEAALFGRV
GNVKVLLEHGADPNIRDDENRRAVYFARESRKNREERNFRTQDTYEMLVGRQEIVRLLSGEIPKSKNAFGKPPTP
SLSRSYRFLSSNGGYTKVLHGPIEEYPMTKCGKTVARLERGGKFPSVGAMSGWSHTPAQPLRVDGRQWTDDVFYI
AEIVGHHLASHACDQGICGQYNACHAEKQLIAYFIDRHVFLPRDGLPDPKLEEEITRVEDELERITSCTEIGRVV
ASLRKEKQELDDELFDGDEKLVGKDDEIKKLESKRRDVKTALNQLIASPRARRLRMLECKLEILGVQRQRHEDLI
EMAEAPPPPASLSEAAILVSSVPCDDCKAFTERVNKHFGLCIQLFASV*
Coding >Ani_SJS100_1|g3926.t1
ATGGAGAGACCCTCCCCTGAAGCCGATGTTATCTGGTGGGACTCGAGTTCGTACTACGTACGATGTCCGTTCTGC
GAAGGGGTTCATCGGCATACCGTAAACTGGCAGACCGGTCTGTTTAGAGTATCAGATTGCGAGAAAGGGGAAACT
TACCAATCCTGCTTTCCCATTAATGATCAAGGGGAGGTCGCGTATGAGATTGATAAGAAACGTGGGCGATATGTC
AATATTTGTGTATCGAACGATAGCGATACTGAGGCCGATGACAATGAGGACGAAGACGACGTTGATCGCCTGGCA
ACTGAAATGGCTCATAAGGCTACTATCGCAGCAGAGAGGGAAGAACGTCATCTGAGTATCACCAGGGACGCTAAA
GAAAATATTATCCACACTATAGATGGTGAAAAATATTTCGAATATAGACTGATCTATGACGCCATCACAGACTGC
TTCAATGGCAAAACAAGAGCGGTGCAGGGATATTTGAAGACGTCTAGTGAGACTGAGTTGTTTGTTCGGGGACAA
TTCCCCGATGGTAAAACAATGCTTATCTCTGCGGCGTCAGAAAAGACCCCAGAAATGCTGTCACTTCTCATCGAA
CACGGGGCTGACGTGAATGCCGTTGACAATCATGGAAGGAGTGCTCTCATGGAGGCAGCGCTTTTTGGTCGGGTT
GGCAATGTGAAGGTTCTCCTCGAACACGGTGCAGACCCAAATATCCGGGATGACGAGAATCGACGGGCAGTTTAC
TTTGCTCGAGAGTCTCGCAAAAATCGAGAAGAGAGAAATTTTCGTACCCAGGACACTTACGAAATGCTTGTTGGC
CGCCAAGAGATTGTACGCCTTCTCAGTGGAGAGATTCCAAAGTCAAAGAATGCTTTTGGCAAACCTCCCACACCA
TCGCTCTCTCGGTCCTACCGTTTTCTATCCTCCAACGGTGGATATACGAAGGTATTACATGGACCAATCGAAGAG
TATCCAATGACGAAATGCGGGAAAACAGTGGCGCGACTGGAACGAGGAGGGAAATTCCCGTCTGTTGGTGCGATG
AGCGGATGGTCACATACTCCTGCGCAACCACTAAGAGTCGACGGTCGTCAGTGGACAGATGATGTCTTTTACATC
GCGGAAATAGTGGGCCACCATTTGGCTTCCCATGCTTGTGATCAGGGTATATGCGGTCAGTACAATGCATGCCAC
GCAGAAAAACAGTTGATAGCATATTTCATTGATCGCCATGTTTTCCTTCCACGCGATGGCCTCCCAGATCCGAAA
TTAGAGGAGGAGATCACTAGGGTAGAGGATGAGCTGGAAAGGATAACTTCATGCACGGAAATAGGACGCGTGGTG
GCTTCTCTACGGAAGGAGAAGCAGGAACTCGATGATGAGCTTTTTGATGGAGATGAGAAGCTAGTCGGAAAAGAT
GATGAGATCAAGAAACTGGAGTCAAAACGCAGGGATGTTAAAACCGCACTAAATCAGCTTATTGCTAGTCCTCGC
GCGCGACGATTACGGATGCTAGAATGCAAGCTGGAGATACTAGGTGTGCAGCGACAGAGACATGAAGACCTGATC
GAAATGGCTGAGGCACCACCGCCACCGGCTTCACTATCCGAAGCGGCCATATTGGTCAGTTCAGTTCCTTGCGAT
GACTGCAAAGCGTTCACGGAAAGAGTCAACAAGCACTTTGGATTATGTATACAGTTATTCGCATCAGTTTGA
Transcript >Ani_SJS100_1|g3926.t1
ATGGAGAGACCCTCCCCTGAAGCCGATGTTATCTGGTGGGACTCGAGTTCGTACTACGTACGATGTCCGTTCTGC
GAAGGGGTTCATCGGCATACCGTAAACTGGCAGACCGGTCTGTTTAGAGTATCAGATTGCGAGAAAGGGGAAACT
TACCAATCCTGCTTTCCCATTAATGATCAAGGGGAGGTCGCGTATGAGATTGATAAGAAACGTGGGCGATATGTC
AATATTTGTGTATCGAACGATAGCGATACTGAGGCCGATGACAATGAGGACGAAGACGACGTTGATCGCCTGGCA
ACTGAAATGGCTCATAAGGCTACTATCGCAGCAGAGAGGGAAGAACGTCATCTGAGTATCACCAGGGACGCTAAA
GAAAATATTATCCACACTATAGATGGTGAAAAATATTTCGAATATAGACTGATCTATGACGCCATCACAGACTGC
TTCAATGGCAAAACAAGAGCGGTGCAGGGATATTTGAAGACGTCTAGTGAGACTGAGTTGTTTGTTCGGGGACAA
TTCCCCGATGGTAAAACAATGCTTATCTCTGCGGCGTCAGAAAAGACCCCAGAAATGCTGTCACTTCTCATCGAA
CACGGGGCTGACGTGAATGCCGTTGACAATCATGGAAGGAGTGCTCTCATGGAGGCAGCGCTTTTTGGTCGGGTT
GGCAATGTGAAGGTTCTCCTCGAACACGGTGCAGACCCAAATATCCGGGATGACGAGAATCGACGGGCAGTTTAC
TTTGCTCGAGAGTCTCGCAAAAATCGAGAAGAGAGAAATTTTCGTACCCAGGACACTTACGAAATGCTTGTTGGC
CGCCAAGAGATTGTACGCCTTCTCAGTGGAGAGATTCCAAAGTCAAAGAATGCTTTTGGCAAACCTCCCACACCA
TCGCTCTCTCGGTCCTACCGTTTTCTATCCTCCAACGGTGGATATACGAAGGTATTACATGGACCAATCGAAGAG
TATCCAATGACGAAATGCGGGAAAACAGTGGCGCGACTGGAACGAGGAGGGAAATTCCCGTCTGTTGGTGCGATG
AGCGGATGGTCACATACTCCTGCGCAACCACTAAGAGTCGACGGTCGTCAGTGGACAGATGATGTCTTTTACATC
GCGGAAATAGTGGGCCACCATTTGGCTTCCCATGCTTGTGATCAGGGTATATGCGGTCAGTACAATGCATGCCAC
GCAGAAAAACAGTTGATAGCATATTTCATTGATCGCCATGTTTTCCTTCCACGCGATGGCCTCCCAGATCCGAAA
TTAGAGGAGGAGATCACTAGGGTAGAGGATGAGCTGGAAAGGATAACTTCATGCACGGAAATAGGACGCGTGGTG
GCTTCTCTACGGAAGGAGAAGCAGGAACTCGATGATGAGCTTTTTGATGGAGATGAGAAGCTAGTCGGAAAAGAT
GATGAGATCAAGAAACTGGAGTCAAAACGCAGGGATGTTAAAACCGCACTAAATCAGCTTATTGCTAGTCCTCGC
GCGCGACGATTACGGATGCTAGAATGCAAGCTGGAGATACTAGGTGTGCAGCGACAGAGACATGAAGACCTGATC
GAAATGGCTGAGGCACCACCGCCACCGGCTTCACTATCCGAAGCGGCCATATTGGTCAGTTCAGTTCCTTGCGAT
GACTGCAAAGCGTTCACGGAAAGAGTCAACAAGCACTTTGGATTATGTATACAGTTATTCGCATCAGTTTGA
Gene >Ani_SJS100_1|g3926.t1
ATGGAGAGACCCTCCCCTGAAGCCGATGTTATCTGGTGGGACTCGAGTTCGTACTACGTACGATGTCCGTTCTGC
GAAGGGGTTCATCGGCATACCGTAAACTGGCAGACCGGTCTGTTTAGAGTATCAGATTGCGAGAAAGGGGAAACT
TACCAATCCTGCTTTCCCATTAATGATCAAGGGGAGGTCGCGTATGAGATTGATAAGAAACGTGGGCGATATGTC
AATATTTGTGTATCGAACGATAGCGATACTGAGGCCGATGACAATGAGGACGAAGACGACGTTGATCGCCTGGCA
ACTGAAATGGCTCATAAGGCTACTATCGCAGCAGAGAGGGAAGAACGTCATCTGAGTATCACCAGGGACGCTAAA
GAAAATATTATCCACACTATAGATGGTGAAAAATATTTCGAATATAGACTGATCTATGACGCCATCACAGACTGC
TTCAATGGCAAAACAAGAGCGGTGCAGGGATATTTGAAGACGTCTAGTGAGACTGAGTTGTTTGTTCGGGGACAA
TTCCCCGATGGTAAAACAATGCTTATCTCTGCGGCGTCAGAAAAGACCCCAGAAATGCTGTCACTTCTCATCGAA
CACGGGGCTGACGTGAATGCCGTTGACAATCATGGAAGGAGTGCTCTCATGGAGGCAGCGCTTTTTGGTCGGGTT
GGCAATGTGAAGGTTCTCCTCGAACACGGTGCAGACCCAAATATCCGGGATGACGAGAATCGACGGGCAGTTTAC
TTTGCTCGAGAGTCTCGCAAAAATCGAGAAGAGAGAAATTTTCGTACCCAGGACACTTACGAAATGCTTGTTGGC
CGCCAAGAGATTGTACGCCTTCTCAGTGGAGAGATTCCAAAGTCAAAGAATGCTTTTGGCAAACCTCCCACACCA
TCGCTCTCTCGGTCCTACCGTTTTCTATCCTCCAACGGTGGATATACGAAGGTATTACATGGACCAATCGAAGAG
TATCCAATGACGAAATGCGGGAAAACAGTGGCGCGACTGGAACGAGGAGGGAAATTCCCGTCTGTTGGTGCGATG
AGCGGATGGTCACATACTCCTGCGCAACCACTAAGAGTCGACGGTCGTCAGTGGACAGATGATGTCTTTTACATC
GCGGAAATAGTGGGCCACCATTTGGCTTCCCATGCTTGTGATCAGGGTATATGCGGTCAGTACAATGCATGCCAC
GCAGAAAAACAGTTGATAGCATATTTCATTGATCGCCATGTTTTCCTTCCACGCGATGGCCTCCCAGATCCGAAA
TTAGAGGAGGAGATCACTAGGGTAGAGGATGAGCTGGAAAGGATAACTTCATGCACGGAAATAGGACGCGTGGTG
GCTTCTCTACGGAAGGAGAAGCAGGAACTCGATGATGAGCTTTTTGATGGAGATGAGAAGCTAGTCGGAAAAGAT
GATGAGATCAAGAAACTGGAGTCAAAACGCAGGGATGTTAAAACCGCACTAAATCAGCTTATTGCTAGTCCTCGC
GCGCGACGATTACGGATGCTAGAATGCAAGCTGGAGATACTAGGTGTGCAGCGACAGAGACATGAAGACCTGATC
GAAATGGCTGAGGCACCACCGCCACCGGCTTCACTATCCGAAGCGGCCATATTGGTCAGTTCAGTTCCTTGCGAT
GACTGCAAAGCGTTCACGGAAAGAGTCAACAAGCACTTTGGATTATGTATACAGTTATTCGCATCAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail