Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3912.t1
Gene name
Locationscaffold_018:386391..388313
Strand+
Gene length (bp)1922
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.3E-28 44 251
PF00083 Sugar_tr Sugar (and other) transporter 1.3E-12 411 548
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-22 50 505

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 82 104 22
3 113 130 17
4 145 167 22
5 180 202 22
6 217 239 22
7 335 357 22
8 397 419 22
9 432 449 17
10 453 470 17
11 491 513 22
12 528 550 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3912.t1
MGKFRTRWYKTDRAQDFEHEQDRDVRARQVYDTIDRQGFQYLIVFVAGVGFFLDGYTLFASNMALPMISYVYWKK
EVSSIKITLFNIATLGGTLLGQVLFGYLADRNGRKKMYGLELILMITSTLGVVMASRGENDSMSIYAWLIWWRIV
VGIGVGADYPLSSVITSEFAPTKHRARMMASVFFMQPLGQIWANLVSLIVIATSRSDTNDLTMSVDRMWRYVIGI
GVIPAAIATCFRFFVPESPRFLMEIDDDPVKVEFDATALFTEPNAVSSSPTLETESWHNFPGQAYSLTTITAEDR
SSTSQTGILQPATLNSHWRLTWKDIVQYFWVEGNWRTLAGTAMSWFFLDFGFYGISLSSPQFLAKTWGSIHLSAP
APYWETNDSPGASVYDMFFASCTHALVILNVGSFAGGLLLILVIHKLDRVALQKYSFLALSALFIALGCMLITIQ
KEGPVAVVLYVIGQALFNFGPNATTYIIPAEIFPTRYRATCHGLSAGAGKIGSIVVQVFSAYYNFGGGFGEEPVK
RHGYIMIVFAGCMLFGAIVTCWIPPIQRKPDGSGRGKLWGGKTETLETLALGRLGLDSRYANQGRRRRRDVVT*
Coding >Ani_SJS100_1|g3912.t1
ATGGGCAAGTTTCGCACGCGATGGTACAAGACTGATCGAGCTCAGGATTTTGAGCATGAGCAGGATCGAGATGTT
CGCGCTCGGCAGGTGTACGACACAATCGACCGCCAGGGATTTCAATACTTGATCGTCTTTGTTGCAGGCGTTGGC
TTCTTTCTCGATGGATACACCCTATTTGCAAGCAACATGGCACTTCCAATGATCTCCTACGTCTACTGGAAGAAA
GAGGTGTCTTCGATCAAGATTACTTTATTTAACATTGCAACATTAGGCGGGACGCTACTGGGACAGGTCTTGTTT
GGGTACCTGGCTGACCGGAACGGACGTAAGAAGATGTATGGCTTGGAGCTGATACTCATGATCACGTCAACACTG
GGCGTCGTTATGGCCTCCCGCGGGGAGAATGATTCGATGAGCATCTACGCATGGCTCATATGGTGGCGTATAGTT
GTCGGGATTGGTGTCGGAGCCGACTATCCTTTGAGTTCAGTCATCACAAGCGAATTTGCCCCCACCAAGCACCGA
GCACGAATGATGGCTTCGGTGTTCTTCATGCAACCTTTAGGGCAGATCTGGGCAAACCTTGTGTCGTTGATTGTC
ATCGCCACCAGCCGTTCAGATACCAATGATTTGACCATGTCTGTCGATAGAATGTGGCGCTACGTCATTGGTATC
GGTGTGATTCCGGCAGCAATAGCAACTTGCTTCCGGTTCTTCGTTCCGGAGTCGCCACGCTTCCTCATGGAGATC
GACGATGACCCAGTGAAAGTCGAGTTCGATGCAACCGCACTCTTTACCGAACCAAATGCTGTTTCCTCCTCCCCG
ACTCTCGAAACCGAAAGCTGGCACAATTTCCCGGGGCAAGCATATTCCCTGACTACGATCACGGCGGAAGACCGA
TCCTCCACATCCCAGACCGGCATCCTTCAACCAGCGACTTTAAACTCTCACTGGCGCTTAACGTGGAAGGACATC
GTACAATACTTCTGGGTGGAAGGTAATTGGCGAACTCTAGCTGGGACAGCTATGTCCTGGTTCTTCTTAGACTTT
GGTTTCTATGGTATCAGTCTCTCCAGCCCGCAATTTTTGGCCAAAACCTGGGGATCCATTCATTTGAGCGCGCCT
GCGCCTTACTGGGAGACGAACGACAGTCCTGGTGCAAGCGTCTATGACATGTTCTTCGCAAGTTGCACTCACGCG
CTGGTCATCTTGAATGTGGGTAGCTTTGCCGGCGGGCTTCTCCTCATCTTAGTGATCCACAAACTGGACAGAGTC
GCTCTACAAAAATACTCTTTTCTCGCACTCTCCGCACTCTTCATCGCCCTGGGTTGCATGCTTATCACCATACAA
AAAGAAGGTCCTGTGGCCGTTGTCTTGTACGTCATTGGCCAGGCGCTCTTCAACTTTGGACCCAACGCTACAACG
TACATCATCCCGGCTGAAATATTCCCCACCCGCTACCGTGCTACCTGTCACGGACTTAGCGCCGGCGCTGGCAAG
ATCGGCTCTATAGTGGTTCAGGTCTTTTCCGCCTACTACAACTTCGGTGGTGGTTTCGGAGAGGAACCGGTAAAG
CGGCACGGCTACATTATGATCGTCTTTGCTGGATGCATGCTCTTTGGGGCGATAGTAACATGCTGGATACCACCT
ATCCAAAGAAAGCCTGATGGATCCGGTAGAGGCAAACTGTGGGGAGGCAAGACGGAGACGCTGGAGACTTTGGCT
CTTGGTCGACTCGGCTTGGACAGTCGATATGCGAATCAGGGCAGAAGGCGAAGGAGGGACGTTGTTACATGA
Transcript >Ani_SJS100_1|g3912.t1
ATGGGCAAGTTTCGCACGCGATGGTACAAGACTGATCGAGCTCAGGATTTTGAGCATGAGCAGGATCGAGATGTT
CGCGCTCGGCAGGTGTACGACACAATCGACCGCCAGGGATTTCAATACTTGATCGTCTTTGTTGCAGGCGTTGGC
TTCTTTCTCGATGGATACACCCTATTTGCAAGCAACATGGCACTTCCAATGATCTCCTACGTCTACTGGAAGAAA
GAGGTGTCTTCGATCAAGATTACTTTATTTAACATTGCAACATTAGGCGGGACGCTACTGGGACAGGTCTTGTTT
GGGTACCTGGCTGACCGGAACGGACGTAAGAAGATGTATGGCTTGGAGCTGATACTCATGATCACGTCAACACTG
GGCGTCGTTATGGCCTCCCGCGGGGAGAATGATTCGATGAGCATCTACGCATGGCTCATATGGTGGCGTATAGTT
GTCGGGATTGGTGTCGGAGCCGACTATCCTTTGAGTTCAGTCATCACAAGCGAATTTGCCCCCACCAAGCACCGA
GCACGAATGATGGCTTCGGTGTTCTTCATGCAACCTTTAGGGCAGATCTGGGCAAACCTTGTGTCGTTGATTGTC
ATCGCCACCAGCCGTTCAGATACCAATGATTTGACCATGTCTGTCGATAGAATGTGGCGCTACGTCATTGGTATC
GGTGTGATTCCGGCAGCAATAGCAACTTGCTTCCGGTTCTTCGTTCCGGAGTCGCCACGCTTCCTCATGGAGATC
GACGATGACCCAGTGAAAGTCGAGTTCGATGCAACCGCACTCTTTACCGAACCAAATGCTGTTTCCTCCTCCCCG
ACTCTCGAAACCGAAAGCTGGCACAATTTCCCGGGGCAAGCATATTCCCTGACTACGATCACGGCGGAAGACCGA
TCCTCCACATCCCAGACCGGCATCCTTCAACCAGCGACTTTAAACTCTCACTGGCGCTTAACGTGGAAGGACATC
GTACAATACTTCTGGGTGGAAGGTAATTGGCGAACTCTAGCTGGGACAGCTATGTCCTGGTTCTTCTTAGACTTT
GGTTTCTATGGTATCAGTCTCTCCAGCCCGCAATTTTTGGCCAAAACCTGGGGATCCATTCATTTGAGCGCGCCT
GCGCCTTACTGGGAGACGAACGACAGTCCTGGTGCAAGCGTCTATGACATGTTCTTCGCAAGTTGCACTCACGCG
CTGGTCATCTTGAATGTGGGTAGCTTTGCCGGCGGGCTTCTCCTCATCTTAGTGATCCACAAACTGGACAGAGTC
GCTCTACAAAAATACTCTTTTCTCGCACTCTCCGCACTCTTCATCGCCCTGGGTTGCATGCTTATCACCATACAA
AAAGAAGGTCCTGTGGCCGTTGTCTTGTACGTCATTGGCCAGGCGCTCTTCAACTTTGGACCCAACGCTACAACG
TACATCATCCCGGCTGAAATATTCCCCACCCGCTACCGTGCTACCTGTCACGGACTTAGCGCCGGCGCTGGCAAG
ATCGGCTCTATAGTGGTTCAGGTCTTTTCCGCCTACTACAACTTCGGTGGTGGTTTCGGAGAGGAACCGGTAAAG
CGGCACGGCTACATTATGATCGTCTTTGCTGGATGCATGCTCTTTGGGGCGATAGTAACATGCTGGATACCACCT
ATCCAAAGAAAGCCTGATGGATCCGGTAGAGGCAAACTGTGGGGAGGCAAGACGGAGACGCTGGAGACTTTGGCT
CTTGGTCGACTCGGCTTGGACAGTCGATATGCGAATCAGGGCAGAAGGCGAAGGAGGGACGTTGTTACATGA
Gene >Ani_SJS100_1|g3912.t1
ATGGGCAAGTTTCGCACGCGATGGTACAAGACTGATCGAGCTCAGGATTTTGAGCATGAGCAGGTAGGGGCGTCT
TAGATGCTTGACAAATCCTGAATCTGCTAGCTAATACTGTGTTGGTGTCATAGGATCGAGATGTTCGCGCTCGGC
AGGTGTACGACACAATCGACCGCCAGGGATTTCAATACTTGATCGTCTTTGTTGCAGGCGTTGGCTTCTTTCTCG
ATGGATACACCCTATTTGCAAGCAACATGGCACTTCCAATGATCTCCTACGTCTACTGGAAGAAAGAGGTGTCTT
CGATCAAGATTACTTTATTTAACATTGCAACATTAGGCGGGACGCTACTGGGACAGGTCTTGTTTGGGTACCTGG
CTGACCGGAACGGACGTAAGAAGATGTATGGCTTGGAGCTGATACTCATGATCACGTCAACACTGGGCGTCGTTA
TGGCCTCCCGCGGGGAGAATGATTCGATGAGCATCTACGCATGGCTCATATGGTGGCGTATAGTTGTCGGGATTG
GTGTCGGAGCCGACTATCCTTTGAGTTCAGTCATCACAAGCGAATTTGCCCCCACCAAGCACCGAGCACGAATGA
TGGCTTCGGTGTTCTTCATGCAACCTTTAGGGCAGATCTGGGCAAACCTTGTGTCGTTGATTGTCATCGCCACCA
GCCGTTCAGATACCAATGATTTGACCATGTCTGTCGATAGAATGTGGCGCTACGTCATTGGTATCGGTGTGATTC
CGGCAGCAATAGCAACTTGCTTCCGGTTCTTCGTTCCGGAGTCGCCACGCTTCCTCATGGAGATCGACGATGACC
CAGTGAAAGTCGAGTTCGATGCAACCGCACTCTTTACCGAACCAAATGCTGTTTCCTCCTCCCCGACTCTCGAAA
CCGAAAGCTGGCACAATTTCCCGGGGCAAGCATATTCCCTGACTACGATCACGGCGGAAGACCGATCCTCCACAT
CCCAGACCGGCATCCTTCAACCAGCGACTTTAAACTCTCACTGGCGCTTAACGTGGAAGGACATCGTACAATACT
TCTGGGTGGAAGGTAATTGGCGAACTCTAGCTGGGACAGCTATGTCCTGGTTCTTCTTAGACTTTGGTTTCTATG
GTATCAGTCTCTCCAGCCCGCAATTTTTGGCCAAAACCTGGGGATCCATTCATTTGAGCGCGCCTGCGCCTTACT
GGGAGACGAACGACAGTCCTGGTGCAAGCGTCTATGACATGTTCTTCGCAAGTTGCACTCACGCGCTGGTCATCT
TGAATGTGGGTAGCTTTGCCGGCGGGCTTCTCCTCATCTTAGTGATCCACAAACTGGACAGAGTCGCTCTACAAA
AATACTCTTTTCTCGCACTCTCCGCACTCTTCATCGCCCTGGGTTGCATGCTTATCACCATACAAAAAGAAGGTC
CTGTGGCCGTTGTCTTGTACGTCATTGGCCAGGCGCTCTTCAACTTTGGTATGTAACCGGCCTCTACCATAGGGT
TCTCCTGGAAGTCGCTAACCAACCTTTATATAGGACCCAACGCTACAACGTACATCATCCCGGCTGAAATATTCC
CCACCCGCTACCGTGCTACCTGTCACGGACTTAGCGCCGGCGCTGGCAAGATCGGCTCTATAGTGGTTCAGGTCT
TTTCCGCCTACTACAACTTCGGTGGTGGTTTCGGAGAGGAACCGGTAAAGCGGCACGGCTACATTATGATCGTCT
TTGCTGGATGCATGCTCTTTGGGGCGATAGTAACATGCTGGATACCACCTATCCAAAGAAAGCCTGATGGATCCG
GTAGAGGCAAACTGTGGGGAGGCAAGACGGAGACGCTGGAGACTTTGGCTCTTGGTCGACTCGGCTTGGACAGTC
GATATGCGAATCAGGGCAGAAGGCGAAGGAGGGACGTTGTTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail