Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3754.t1
Gene name
Locationscaffold_017:381954..384527
Strand+
Gene length (bp)2573
Transcript length (bp)2481
Coding sequence length (bp)2481
Protein length (aa) 827

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 3.3E-11 294 384
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.5E-25 605 695

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 253 275 22
2 297 319 22
3 361 383 22
4 403 425 22
5 558 580 22
6 600 622 22
7 674 696 22
8 711 733 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3754.t1
MLAPGSGNVSLRTVSSNRPQLMHTQSQQSIAASDDYYSFSSPSSSARSRASGSRLTVARYATPNSHPPSRTSSPS
ISRTHLASQPAGARSEHSLNVPSENRNFVTPPSQTIRAVEEEDPEPSPMSDTTSRRELSDSYAGRPPTPGVDDSP
YIHFAISQLTRDEEVAGPRRRSSLASNDSPLEPLLWDEGLGCFIRSPGQPATPPARQPQQSSDSIGRAPQNSVDP
ESFVAVEPPHDSLLYPPLDYVPIVLRSWALAAIIICCLLMIAGLSFCNVWSRRHDGLWDYTGLGGSHYFVMQFLP
QILGMVITIWTFVIQAAVYRIMPFAIMASERPLGHVLQSLPILSRNFLIPDFSYFRHGEGIVGFSLFTMWLSNLI
TLPLLSCLFQAKWYLIDGQGTWRWASVSAVGWTLVAIYALLTIGLLLLMFRFVRTWSGLMWDPVSLADLISIIQR
SNILHDFEQSETLPNVGESLDPRFLRLGYWKLSNRADIFYGIGEVDAPVRTPSLHRKEKNLQMQSHGLSRVSFDI
EQHGLAEKEEYYQHLYSPAIRYRWIPWFLRDGFVVLWTVIICALFIAFVLVSFIHGAIKDGFPPRLPTLPSTGAF
SSSNFCYSFIPAFIGNVLFLAWQPIDVYFRALQPFAALASPTGARAEQSLLLSYPSCFPFQVTLVAVLNKHYKVA
WVSFMSTVSAAIPILAGGMFIALYHPSDGTILISALMPAFYAIVAFCALYMVSFLCIWPRRCRRLPHDISTLADQ
MSFLYQSPLLADKILREPRSKADLVTRLVVAPPGDREHSMYGFGIYVGRDGKEHLGIDRFDRPGRADMLITTGYL
R*
Coding >Ani_SJS100_1|g3754.t1
ATGCTCGCTCCGGGCTCTGGGAATGTGAGTCTCAGAACTGTCAGTTCTAATCGACCACAATTAATGCACACCCAG
TCTCAACAGTCTATCGCCGCCTCCGACGACTACTACTCTTTCTCAAGTCCATCCTCAAGTGCAAGATCCCGAGCC
AGTGGCAGTCGACTCACCGTGGCGCGGTATGCGACACCGAACTCTCATCCTCCGTCCCGAACATCGTCTCCTAGC
ATCTCTCGGACGCATCTAGCCTCGCAGCCGGCTGGTGCACGATCGGAACATTCCTTAAACGTTCCGAGTGAGAAC
AGGAATTTTGTTACACCCCCTTCTCAGACAATACGTGCAGTCGAAGAGGAAGATCCTGAGCCCAGCCCCATGTCA
GATACCACGAGTCGCCGGGAACTCAGTGACAGCTATGCTGGGCGGCCGCCTACTCCTGGGGTGGATGACTCGCCA
TACATTCATTTTGCCATCAGCCAGCTTACGCGTGATGAGGAAGTTGCTGGGCCCAGACGGCGAAGCTCGCTCGCC
AGTAATGACAGTCCTCTCGAGCCACTGCTTTGGGATGAAGGATTGGGCTGCTTCATTCGCTCGCCTGGACAACCG
GCAACCCCGCCAGCACGGCAACCGCAACAATCATCCGACTCTATCGGGAGGGCGCCCCAAAACTCGGTAGATCCA
GAATCGTTCGTCGCGGTGGAACCTCCGCATGACAGCCTGCTGTACCCACCGTTGGACTATGTGCCTATAGTATTA
CGGTCATGGGCTCTGGCTGCCATAATTATCTGTTGCCTGCTCATGATTGCTGGACTGAGCTTCTGCAATGTATGG
TCGCGGCGGCATGACGGGCTTTGGGACTATACGGGACTAGGGGGATCCCACTACTTTGTGATGCAATTCCTACCG
CAAATCTTGGGCATGGTCATTACTATCTGGACCTTCGTGATCCAAGCGGCAGTGTATAGAATAATGCCGTTTGCC
ATCATGGCTTCAGAGCGGCCGCTCGGCCACGTCCTTCAGAGCCTGCCTATCCTATCACGGAACTTCCTGATACCG
GACTTCTCCTACTTTCGGCATGGCGAGGGCATAGTCGGTTTCTCTTTGTTCACCATGTGGTTGTCAAACCTGATC
ACACTACCACTGCTAAGTTGCCTCTTCCAGGCTAAGTGGTACTTGATCGATGGACAAGGGACGTGGCGGTGGGCC
TCGGTTTCGGCGGTTGGGTGGACCCTGGTGGCCATCTATGCGTTGTTGACCATTGGCCTGCTCCTGCTCATGTTT
CGTTTTGTACGCACATGGTCGGGGTTGATGTGGGACCCTGTGAGTCTCGCCGACCTGATTTCAATCATCCAGCGA
TCGAACATCTTGCACGACTTTGAACAATCGGAGACTCTGCCGAATGTCGGCGAATCGCTCGATCCGCGATTCCTC
CGATTGGGCTACTGGAAACTATCAAACCGTGCGGATATATTCTATGGAATTGGCGAGGTGGATGCACCGGTTCGG
ACGCCGTCATTACACCGAAAGGAGAAGAACCTTCAGATGCAGTCACATGGCCTGTCAAGGGTATCATTCGACATT
GAGCAGCATGGTCTCGCAGAGAAGGAAGAGTACTATCAGCATCTATACTCACCCGCTATCCGCTATCGTTGGATC
CCATGGTTTCTTCGCGACGGCTTTGTCGTTCTATGGACGGTAATCATTTGCGCCTTGTTTATTGCATTCGTGTTG
GTCAGCTTCATCCACGGTGCGATCAAAGACGGATTCCCCCCGCGTTTGCCAACACTGCCATCTACTGGTGCATTT
TCCTCTTCCAACTTTTGCTATAGCTTCATTCCTGCTTTCATTGGGAATGTCCTCTTCCTAGCATGGCAGCCGATC
GACGTCTATTTCCGTGCGTTGCAGCCTTTTGCAGCTCTAGCTTCCCCGACCGGTGCTCGAGCAGAGCAGAGCCTT
TTGTTGTCATACCCGTCCTGCTTTCCCTTCCAGGTGACGCTAGTGGCGGTTTTGAACAAGCATTACAAAGTGGCC
TGGGTTTCATTCATGAGTACGGTGTCTGCGGCGATTCCTATCCTGGCCGGAGGGATGTTCATTGCCTTGTACCAT
CCGTCTGACGGGACGATCCTGATCTCTGCTCTGATGCCTGCGTTCTATGCTATTGTGGCCTTCTGTGCACTATAC
ATGGTGTCTTTCCTGTGCATTTGGCCCCGTCGCTGCCGCCGCCTGCCACATGACATTAGCACTTTGGCTGATCAG
ATGAGCTTCCTATACCAAAGCCCACTGCTCGCCGATAAAATCCTGCGCGAGCCTCGGAGCAAGGCGGATCTGGTC
ACTCGATTGGTCGTCGCGCCTCCTGGAGATCGGGAGCATTCTATGTACGGCTTTGGCATCTATGTTGGTCGAGAT
GGCAAGGAGCATCTAGGAATTGATCGTTTCGACCGTCCTGGCCGGGCGGATATGTTGATTACTACCGGATATTTA
CGATAG
Transcript >Ani_SJS100_1|g3754.t1
ATGCTCGCTCCGGGCTCTGGGAATGTGAGTCTCAGAACTGTCAGTTCTAATCGACCACAATTAATGCACACCCAG
TCTCAACAGTCTATCGCCGCCTCCGACGACTACTACTCTTTCTCAAGTCCATCCTCAAGTGCAAGATCCCGAGCC
AGTGGCAGTCGACTCACCGTGGCGCGGTATGCGACACCGAACTCTCATCCTCCGTCCCGAACATCGTCTCCTAGC
ATCTCTCGGACGCATCTAGCCTCGCAGCCGGCTGGTGCACGATCGGAACATTCCTTAAACGTTCCGAGTGAGAAC
AGGAATTTTGTTACACCCCCTTCTCAGACAATACGTGCAGTCGAAGAGGAAGATCCTGAGCCCAGCCCCATGTCA
GATACCACGAGTCGCCGGGAACTCAGTGACAGCTATGCTGGGCGGCCGCCTACTCCTGGGGTGGATGACTCGCCA
TACATTCATTTTGCCATCAGCCAGCTTACGCGTGATGAGGAAGTTGCTGGGCCCAGACGGCGAAGCTCGCTCGCC
AGTAATGACAGTCCTCTCGAGCCACTGCTTTGGGATGAAGGATTGGGCTGCTTCATTCGCTCGCCTGGACAACCG
GCAACCCCGCCAGCACGGCAACCGCAACAATCATCCGACTCTATCGGGAGGGCGCCCCAAAACTCGGTAGATCCA
GAATCGTTCGTCGCGGTGGAACCTCCGCATGACAGCCTGCTGTACCCACCGTTGGACTATGTGCCTATAGTATTA
CGGTCATGGGCTCTGGCTGCCATAATTATCTGTTGCCTGCTCATGATTGCTGGACTGAGCTTCTGCAATGTATGG
TCGCGGCGGCATGACGGGCTTTGGGACTATACGGGACTAGGGGGATCCCACTACTTTGTGATGCAATTCCTACCG
CAAATCTTGGGCATGGTCATTACTATCTGGACCTTCGTGATCCAAGCGGCAGTGTATAGAATAATGCCGTTTGCC
ATCATGGCTTCAGAGCGGCCGCTCGGCCACGTCCTTCAGAGCCTGCCTATCCTATCACGGAACTTCCTGATACCG
GACTTCTCCTACTTTCGGCATGGCGAGGGCATAGTCGGTTTCTCTTTGTTCACCATGTGGTTGTCAAACCTGATC
ACACTACCACTGCTAAGTTGCCTCTTCCAGGCTAAGTGGTACTTGATCGATGGACAAGGGACGTGGCGGTGGGCC
TCGGTTTCGGCGGTTGGGTGGACCCTGGTGGCCATCTATGCGTTGTTGACCATTGGCCTGCTCCTGCTCATGTTT
CGTTTTGTACGCACATGGTCGGGGTTGATGTGGGACCCTGTGAGTCTCGCCGACCTGATTTCAATCATCCAGCGA
TCGAACATCTTGCACGACTTTGAACAATCGGAGACTCTGCCGAATGTCGGCGAATCGCTCGATCCGCGATTCCTC
CGATTGGGCTACTGGAAACTATCAAACCGTGCGGATATATTCTATGGAATTGGCGAGGTGGATGCACCGGTTCGG
ACGCCGTCATTACACCGAAAGGAGAAGAACCTTCAGATGCAGTCACATGGCCTGTCAAGGGTATCATTCGACATT
GAGCAGCATGGTCTCGCAGAGAAGGAAGAGTACTATCAGCATCTATACTCACCCGCTATCCGCTATCGTTGGATC
CCATGGTTTCTTCGCGACGGCTTTGTCGTTCTATGGACGGTAATCATTTGCGCCTTGTTTATTGCATTCGTGTTG
GTCAGCTTCATCCACGGTGCGATCAAAGACGGATTCCCCCCGCGTTTGCCAACACTGCCATCTACTGGTGCATTT
TCCTCTTCCAACTTTTGCTATAGCTTCATTCCTGCTTTCATTGGGAATGTCCTCTTCCTAGCATGGCAGCCGATC
GACGTCTATTTCCGTGCGTTGCAGCCTTTTGCAGCTCTAGCTTCCCCGACCGGTGCTCGAGCAGAGCAGAGCCTT
TTGTTGTCATACCCGTCCTGCTTTCCCTTCCAGGTGACGCTAGTGGCGGTTTTGAACAAGCATTACAAAGTGGCC
TGGGTTTCATTCATGAGTACGGTGTCTGCGGCGATTCCTATCCTGGCCGGAGGGATGTTCATTGCCTTGTACCAT
CCGTCTGACGGGACGATCCTGATCTCTGCTCTGATGCCTGCGTTCTATGCTATTGTGGCCTTCTGTGCACTATAC
ATGGTGTCTTTCCTGTGCATTTGGCCCCGTCGCTGCCGCCGCCTGCCACATGACATTAGCACTTTGGCTGATCAG
ATGAGCTTCCTATACCAAAGCCCACTGCTCGCCGATAAAATCCTGCGCGAGCCTCGGAGCAAGGCGGATCTGGTC
ACTCGATTGGTCGTCGCGCCTCCTGGAGATCGGGAGCATTCTATGTACGGCTTTGGCATCTATGTTGGTCGAGAT
GGCAAGGAGCATCTAGGAATTGATCGTTTCGACCGTCCTGGCCGGGCGGATATGTTGATTACTACCGGATATTTA
CGATAG
Gene >Ani_SJS100_1|g3754.t1
ATGCTCGCTCCGGGCTCTGGGAATGTGAGTCTCAGAACTGTCAGTTGTAAGTTGACTCTGCATAACCTTGGCACC
CAGCCAAGGAAAAGCATGATGCGTCTTCGAATTCAGGCTGACCGATGACTGATCCCCTCACAGCTAATCGACCAC
AATTAATGCACACCCAGTCTCAACAGTCTATCGCCGCCTCCGACGACTACTACTCTTTCTCAAGTCCATCCTCAA
GTGCAAGATCCCGAGCCAGTGGCAGTCGACTCACCGTGGCGCGGTATGCGACACCGAACTCTCATCCTCCGTCCC
GAACATCGTCTCCTAGCATCTCTCGGACGCATCTAGCCTCGCAGCCGGCTGGTGCACGATCGGAACATTCCTTAA
ACGTTCCGAGTGAGAACAGGAATTTTGTTACACCCCCTTCTCAGACAATACGTGCAGTCGAAGAGGAAGATCCTG
AGCCCAGCCCCATGTCAGATACCACGAGTCGCCGGGAACTCAGTGACAGCTATGCTGGGCGGCCGCCTACTCCTG
GGGTGGATGACTCGCCATACATTCATTTTGCCATCAGCCAGCTTACGCGTGATGAGGAAGTTGCTGGGCCCAGAC
GGCGAAGCTCGCTCGCCAGTAATGACAGTCCTCTCGAGCCACTGCTTTGGGATGAAGGATTGGGCTGCTTCATTC
GCTCGCCTGGACAACCGGCAACCCCGCCAGCACGGCAACCGCAACAATCATCCGACTCTATCGGGAGGGCGCCCC
AAAACTCGGTAGATCCAGAATCGTTCGTCGCGGTGGAACCTCCGCATGACAGCCTGCTGTACCCACCGTTGGACT
ATGTGCCTATAGTATTACGGTCATGGGCTCTGGCTGCCATAATTATCTGTTGCCTGCTCATGATTGCTGGACTGA
GCTTCTGCAATGTATGGTCGCGGCGGCATGACGGGCTTTGGGACTATACGGGACTAGGGGGATCCCACTACTTTG
TGATGCAATTCCTACCGCAAATCTTGGGCATGGTCATTACTATCTGGACCTTCGTGATCCAAGCGGCAGTGTATA
GAATAATGCCGTTTGCCATCATGGCTTCAGAGCGGCCGCTCGGCCACGTCCTTCAGAGCCTGCCTATCCTATCAC
GGAACTTCCTGATACCGGACTTCTCCTACTTTCGGCATGGCGAGGGCATAGTCGGTTTCTCTTTGTTCACCATGT
GGTTGTCAAACCTGATCACACTACCACTGCTAAGTTGCCTCTTCCAGGCTAAGTGGTACTTGATCGATGGACAAG
GGACGTGGCGGTGGGCCTCGGTTTCGGCGGTTGGGTGGACCCTGGTGGCCATCTATGCGTTGTTGACCATTGGCC
TGCTCCTGCTCATGTTTCGTTTTGTACGCACATGGTCGGGGTTGATGTGGGACCCTGTGAGTCTCGCCGACCTGA
TTTCAATCATCCAGCGATCGAACATCTTGCACGACTTTGAACAATCGGAGACTCTGCCGAATGTCGGCGAATCGC
TCGATCCGCGATTCCTCCGATTGGGCTACTGGAAACTATCAAACCGTGCGGATATATTCTATGGAATTGGCGAGG
TGGATGCACCGGTTCGGACGCCGTCATTACACCGAAAGGAGAAGAACCTTCAGATGCAGTCACATGGCCTGTCAA
GGGTATCATTCGACATTGAGCAGCATGGTCTCGCAGAGAAGGAAGAGTACTATCAGCATCTATACTCACCCGCTA
TCCGCTATCGTTGGATCCCATGGTTTCTTCGCGACGGCTTTGTCGTTCTATGGACGGTAATCATTTGCGCCTTGT
TTATTGCATTCGTGTTGGTCAGCTTCATCCACGGTGCGATCAAAGACGGATTCCCCCCGCGTTTGCCAACACTGC
CATCTACTGGTGCATTTTCCTCTTCCAACTTTTGCTATAGCTTCATTCCTGCTTTCATTGGGAATGTCCTCTTCC
TAGCATGGCAGCCGATCGACGTCTATTTCCGTGCGTTGCAGCCTTTTGCAGCTCTAGCTTCCCCGACCGGTGCTC
GAGCAGAGCAGAGCCTTTTGTTGTCATACCCGTCCTGCTTTCCCTTCCAGGTGACGCTAGTGGCGGTTTTGAACA
AGCATTACAAAGTGGCCTGGGTTTCATTCATGAGTACGGTGTCTGCGGCGATTCCTATCCTGGCCGGAGGGATGT
TCATTGCCTTGTACCATCCGTCTGACGGGACGATCCTGATCTCTGCTCTGATGCCTGCGTTCTATGCTATTGTGG
CCTTCTGTGCACTATACATGGTGTCTTTCCTGTGCATTTGGCCCCGTCGCTGCCGCCGCCTGCCACATGACATTA
GCACTTTGGCTGATCAGATGAGCTTCCTATACCAAAGCCCACTGCTCGCCGATAAAATCCTGCGCGAGCCTCGGA
GCAAGGCGGATCTGGTCACTCGATTGGTCGTCGCGCCTCCTGGAGATCGGGAGCATTCTATGTACGGCTTTGGCA
TCTATGTTGGTCGAGATGGCAAGGAGCATCTAGGAATTGATCGTTTCGACCGTCCTGGCCGGGCGGATATGTTGA
TTACTACCGGATATTTACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail