Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3672.t1
Gene name
Locationscaffold_017:135603..136888
Strand-
Gene length (bp)1285
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03908 Sec20 Sec20 1.3E-17 159 248

GO

GO Term Description Terminal node
GO:0005484 SNAP receptor activity Yes
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0016192 vesicle-mediated transport No
GO:0051179 localization No
GO:0060090 molecular adaptor activity No
GO:0030674 protein-macromolecule adaptor activity No
GO:0048193 Golgi vesicle transport No
GO:0006810 transport No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 227 249 22
2 254 276 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3672.t1
MASIADLQARLKELSTALSHIQPLVSRLKGFTTAVGQGDQPRLELGTEIHTRLKEAEEQLELLKVEVEALEAAAD
TRRKGVDNEKESERERVIALAGRLADDLKRTRGDFRNAQLQAKRNAEVARRKERELLFTRSQSAERKKQSSEKLT
QDDIVMNASNDVTAALRRTHQLMQAELSRSQFAQETLDQSTAALSSLSESYTDLDSLISSSRNLIGSLLRSQKSD
TWYLETAFYILVGTIIWLVFRRILYGPLWWLVWLPLRLFARFTFAILGAVGITSKAVQSSEPSTMLEYVPQETPM
VEQKVEPNIQSAEGEAVWDQVPVTDEAEEDRLIDEIGKMVEESEEQEETNIDDISEEERQRQAELPRNPKKRMFE
ATDVPQQKDEL*
Coding >Ani_SJS100_1|g3672.t1
ATGGCCAGCATCGCCGATCTACAAGCCCGCTTGAAAGAGCTCTCAACAGCTCTGTCCCACATCCAGCCGCTGGTC
TCTCGGTTAAAGGGCTTTACGACTGCAGTTGGACAGGGCGATCAGCCGCGATTGGAACTAGGGACGGAGATCCAT
ACTCGACTGAAAGAGGCGGAGGAGCAATTGGAGTTGCTGAAGGTCGAGGTTGAGGCCCTGGAGGCTGCAGCGGAT
ACGCGGCGCAAGGGTGTGGATAATGAGAAGGAGTCGGAGAGGGAACGGGTTATTGCCTTGGCTGGACGGTTGGCG
GATGATTTGAAGAGAACGAGAGGAGACTTCCGGAACGCACAATTACAAGCGAAGCGGAACGCTGAAGTTGCCCGA
CGGAAAGAGCGAGAGCTACTGTTTACGAGGTCACAAAGTGCGGAGAGGAAGAAGCAGTCGAGTGAGAAGCTGACG
CAGGATGATATTGTCATGAATGCTTCGAATGATGTTACGGCTGCGCTGAGACGGACGCATCAGTTGATGCAGGCG
GAGCTGTCGCGGAGTCAGTTTGCGCAGGAGACGTTAGATCAATCGACTGCTGCGCTGTCCTCGCTGTCAGAATCC
TATACAGATCTCGATTCTTTGATTTCGTCGTCACGCAATCTCATCGGGTCTTTGCTACGCTCGCAAAAGTCGGAT
ACTTGGTACCTTGAGACGGCTTTCTACATATTGGTTGGCACCATTATTTGGCTTGTCTTCCGGCGGATATTATAT
GGTCCCCTGTGGTGGCTCGTCTGGCTGCCTCTCAGGCTGTTCGCGAGGTTCACGTTTGCTATTTTGGGCGCCGTC
GGGATTACCAGTAAGGCTGTTCAGTCTTCTGAACCTAGTACGATGCTCGAATATGTGCCGCAAGAGACCCCAATG
GTTGAGCAGAAGGTGGAGCCGAACATCCAAAGTGCTGAGGGCGAAGCGGTCTGGGATCAAGTTCCAGTTACGGAT
GAGGCAGAGGAGGACCGCTTAATTGATGAGATCGGCAAAATGGTGGAAGAAAGCGAGGAGCAAGAGGAGACCAAC
ATTGACGACATCTCAGAAGAGGAAAGGCAAAGGCAGGCGGAGTTGCCCCGGAACCCTAAGAAGAGGATGTTCGAG
GCTACGGATGTACCACAGCAGAAGGACGAACTATAG
Transcript >Ani_SJS100_1|g3672.t1
ATGGCCAGCATCGCCGATCTACAAGCCCGCTTGAAAGAGCTCTCAACAGCTCTGTCCCACATCCAGCCGCTGGTC
TCTCGGTTAAAGGGCTTTACGACTGCAGTTGGACAGGGCGATCAGCCGCGATTGGAACTAGGGACGGAGATCCAT
ACTCGACTGAAAGAGGCGGAGGAGCAATTGGAGTTGCTGAAGGTCGAGGTTGAGGCCCTGGAGGCTGCAGCGGAT
ACGCGGCGCAAGGGTGTGGATAATGAGAAGGAGTCGGAGAGGGAACGGGTTATTGCCTTGGCTGGACGGTTGGCG
GATGATTTGAAGAGAACGAGAGGAGACTTCCGGAACGCACAATTACAAGCGAAGCGGAACGCTGAAGTTGCCCGA
CGGAAAGAGCGAGAGCTACTGTTTACGAGGTCACAAAGTGCGGAGAGGAAGAAGCAGTCGAGTGAGAAGCTGACG
CAGGATGATATTGTCATGAATGCTTCGAATGATGTTACGGCTGCGCTGAGACGGACGCATCAGTTGATGCAGGCG
GAGCTGTCGCGGAGTCAGTTTGCGCAGGAGACGTTAGATCAATCGACTGCTGCGCTGTCCTCGCTGTCAGAATCC
TATACAGATCTCGATTCTTTGATTTCGTCGTCACGCAATCTCATCGGGTCTTTGCTACGCTCGCAAAAGTCGGAT
ACTTGGTACCTTGAGACGGCTTTCTACATATTGGTTGGCACCATTATTTGGCTTGTCTTCCGGCGGATATTATAT
GGTCCCCTGTGGTGGCTCGTCTGGCTGCCTCTCAGGCTGTTCGCGAGGTTCACGTTTGCTATTTTGGGCGCCGTC
GGGATTACCAGTAAGGCTGTTCAGTCTTCTGAACCTAGTACGATGCTCGAATATGTGCCGCAAGAGACCCCAATG
GTTGAGCAGAAGGTGGAGCCGAACATCCAAAGTGCTGAGGGCGAAGCGGTCTGGGATCAAGTTCCAGTTACGGAT
GAGGCAGAGGAGGACCGCTTAATTGATGAGATCGGCAAAATGGTGGAAGAAAGCGAGGAGCAAGAGGAGACCAAC
ATTGACGACATCTCAGAAGAGGAAAGGCAAAGGCAGGCGGAGTTGCCCCGGAACCCTAAGAAGAGGATGTTCGAG
GCTACGGATGTACCACAGCAGAAGGACGAACTATAG
Gene >Ani_SJS100_1|g3672.t1
ATGGCCAGCATCGCCGATCTACAAGCCCGCTTGAAAGAGCTCTCAACAGCTCTGTCCCACATCCAGCCGCTGGTC
TCTCGGTTAAAGGGCTTTACGACTGCAGTTGGACAGGGCGATCAGCCGCGATTGGAACTAGGGACGGAGATCCAT
ACTCGACTGAAAGAGGCGGAGGAGCAATTGGAGTTGCTGAAGGTCGAGGTTGAGGCCCTGGAGGCTGCAGCGGAT
ACGCGGCGCAAGGGTGTGGATAATGAGAAGGAGTCGGAGAGGGAACGGGTTATTGCCTTGGCTGGACGGTTGGCG
GATGATTTGAAGAGGTAGGTGGAATCGACTGATTGCTCTTCCTGGATTGTTTACTAATGGGTATGTTACGGCTTT
GGCAGAACGAGAGGAGACTTCCGGAACGCACAATTACAAGCGAAGCGGAACGCTGAAGTTGCCCGACGGAAAGAG
CGAGAGCTACTGTTTACGAGGTCACAAAGTGCGGAGAGGAAGAAGCAGTCGAGTGAGAAGCTGACGCAGGATGAT
ATTGTCATGAATGCTTCGAATGATGTTACGGCTGCGCTGAGACGGACGCATCAGTTGATGCAGGCGGAGCTGTCG
CGGAGTCAGTTTGCGCAGGAGACGTTAGGTTTGTGCTGGTTTACCTTGGGTGCAGGTCAGGGTAATGGCTAACAT
TGGTGGTTTAGATCAATCGACTGCTGCGCTGTCCTCGCTGTCAGAATCCTATACAGATCTCGATTCTTTGATTTC
GTCGTCACGCAATCTCATCGGGTCTTTGCTACGCTCGCAAAAGTCGGATACTTGGTACCTTGAGACGGCTTTCTA
CATATTGGTTGGCACCATTATTTGGCTTGTCTTCCGGCGGATATTATATGGTCCCCTGTGGTGGCTCGTCTGGCT
GCCTCTCAGGCTGTTCGCGAGGTTCACGTTTGCTATTTTGGGCGCCGTCGGGATTACCAGTAAGGCTGTTCAGTC
TTCTGAACCTAGTACGATGCTCGAATATGTGCCGCAAGAGACCCCAATGGTTGAGCAGAAGGTGGAGCCGAACAT
CCAAAGTGCTGAGGGCGAAGCGGTCTGGGATCAAGTTCCAGTTACGGATGAGGCAGAGGAGGACCGCTTAATTGA
TGAGATCGGCAAAATGGTGGAAGAAAGCGAGGAGCAAGAGGAGACCAACATTGACGACATCTCAGAAGAGGAAAG
GCAAAGGCAGGCGGAGTTGCCCCGGAACCCTAAGAAGAGGATGTTCGAGGCTACGGATGTACCACAGCAGAAGGA
CGAACTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail