Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3569.t1
Gene name
Locationscaffold_016:320281..322840
Strand-
Gene length (bp)2559
Transcript length (bp)2559
Coding sequence length (bp)2559
Protein length (aa) 853

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01571 GCV_T Aminomethyltransferase folate-binding domain 5.7E-73 439 721
PF01266 DAO FAD dependent oxidoreductase 1.2E-47 6 379
PF16350 FAO_M FAD dependent oxidoreductase central domain 1.1E-19 382 437
PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain 4.1E-17 750 828

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3569.t1
MAATQRVVIIGAGIVGANLADELVTRGWQDITVVEQGPLNLPGGSTSHAPGLVFQTNGSKTMTRLAQYTVDKLRS
LSDENGMPCFNSIGGLEVATTPARVEELKRKLGYAMSWGVDARLLTKEECLEKYPLLNKDLVLAGLHTPTDGLAL
AARATQLLIARTQQAGVRYRDSTLVTGIEQTGSRVTGVRTSQGIIPADIVISCAGFWGVEIGAMAGVAIPLLPLA
HQYAKTTTVPALANRDVNHRPNGMNASMPILRHQDQDLYYREHGDQVGIGYYGHRPMPVVAASLGQTPEHVDEKH
MPSRLEFTAQDFAPAWKASQELLPVLRETQLEDGFNGIFSFTPDGGPLVGQASNLDGFYVAEAVWVTHSAGVARS
MAELLTDGASTIDLTECELSRFEEVQLSRDYVNETSQQNFVEIYDILHPLQPRESPRQLRVSPFYEKQRALGAFF
LELGGWERPFWYEANAQLLHALPAQWQPPPRDTWSSRYTSPITAVEAWKTRNAVAMYDLTSFHRVQVSGPGAATL
LQRLTTSDITAPPGAITHTLLLNRQGKIRSDIFVARLEPDLFQIGANTATDVAYLAVEARRQRQHTPTQWVQVSD
ITGSTCCIGLWGPRSRAVIRAVSNDDFSTAALPYMSVKRATIAGIPITALRKSYVGELGWEIQTNAEYGSRLWDA
LWQAGKPHGLIAAGRSAMNALRLEKGIRTYGVDMTTEHDPLEAGVFHLVDLDKKEEYVGKAAIQSAAQRKQPPLR
RLRCLTIDDGHSMVMGKEPVYFGGRPVGYVTTAVFSYTTKRPAAYAWLPGRVREGDAVVIEYFGRQIKATVSADP
LFDPRGSKLHREDTGADGFETPLKNRL*
Coding >Ani_SJS100_1|g3569.t1
ATGGCAGCAACACAACGTGTGGTCATCATAGGAGCTGGAATCGTGGGCGCCAACCTCGCCGATGAACTGGTCACT
CGGGGATGGCAGGACATCACCGTCGTCGAGCAGGGCCCGTTGAACCTGCCGGGCGGCTCGACCTCGCACGCTCCC
GGGCTGGTCTTTCAAACCAACGGTTCGAAGACAATGACTCGTCTCGCACAATATACCGTTGACAAACTGCGATCG
CTAAGTGATGAGAATGGCATGCCGTGCTTCAATTCGATAGGAGGTCTGGAGGTGGCCACGACGCCGGCCCGAGTC
GAAGAGCTCAAGCGCAAGCTCGGCTATGCGATGTCCTGGGGTGTTGATGCGCGTCTTCTAACCAAGGAAGAGTGT
TTGGAGAAGTATCCTCTTCTGAACAAGGATCTCGTGCTAGCTGGTCTTCACACTCCGACCGATGGTCTCGCGTTA
GCTGCCCGCGCAACCCAGCTGCTTATCGCCCGGACCCAGCAGGCCGGGGTCCGCTACCGAGACTCGACGCTTGTT
ACAGGCATTGAACAAACAGGATCTCGTGTGACGGGCGTAAGAACCTCCCAGGGTATTATTCCCGCCGATATCGTC
ATCTCCTGCGCCGGCTTTTGGGGCGTCGAAATCGGAGCCATGGCTGGAGTCGCCATCCCTCTTCTACCACTTGCC
CATCAGTATGCGAAGACGACCACCGTGCCCGCTCTAGCGAATCGCGACGTCAACCACCGTCCGAACGGAATGAAT
GCGAGTATGCCCATCTTGCGGCATCAGGATCAGGATCTATACTACCGGGAGCATGGAGATCAGGTGGGGATTGGA
TACTATGGACACCGTCCAATGCCGGTGGTGGCTGCATCCTTGGGGCAGACTCCGGAACACGTTGATGAGAAGCAC
ATGCCCTCTCGACTCGAGTTCACGGCCCAGGACTTTGCGCCCGCCTGGAAGGCCTCGCAGGAACTGCTACCTGTT
CTCCGCGAGACCCAATTGGAGGACGGATTCAACGGCATCTTCTCGTTCACCCCAGACGGGGGGCCCCTCGTTGGA
CAAGCCTCTAACCTCGATGGTTTCTATGTAGCAGAAGCCGTCTGGGTCACCCACTCCGCCGGAGTCGCGCGAAGC
ATGGCGGAGCTGCTCACAGACGGAGCATCCACCATCGATCTCACGGAGTGCGAACTATCTCGCTTCGAGGAAGTA
CAGCTGAGCCGGGACTACGTCAACGAGACCTCGCAACAGAACTTCGTAGAGATCTACGACATCCTCCATCCCCTC
CAACCGAGAGAATCTCCCCGCCAGCTCCGAGTAAGCCCCTTCTACGAGAAACAACGAGCACTGGGCGCCTTCTTC
CTCGAACTCGGCGGCTGGGAGCGCCCATTCTGGTACGAAGCAAACGCACAGCTCCTGCACGCCCTCCCAGCACAA
TGGCAACCACCTCCCCGAGACACCTGGTCATCGCGATACACCTCCCCGATCACTGCCGTGGAAGCATGGAAGACC
CGCAATGCCGTCGCCATGTACGACCTAACCTCCTTCCACCGCGTACAAGTATCCGGACCCGGCGCAGCCACCCTC
CTGCAGCGCCTCACCACAAGCGACATCACCGCCCCTCCCGGCGCCATCACACACACCCTCCTCCTCAACAGACAG
GGCAAAATCCGCAGCGACATCTTCGTCGCTCGTCTGGAACCCGACCTCTTCCAAATCGGCGCCAACACCGCAACC
GATGTCGCCTACTTAGCCGTCGAAGCACGTCGCCAGAGACAACACACCCCGACCCAATGGGTCCAGGTATCCGAC
ATCACCGGCAGCACTTGCTGCATCGGCCTCTGGGGCCCTCGCTCACGGGCCGTGATCCGCGCCGTTTCCAACGAC
GACTTCTCCACCGCCGCTCTACCCTACATGTCCGTCAAACGTGCCACGATAGCCGGGATCCCCATTACCGCGCTC
CGCAAATCCTACGTCGGTGAACTCGGCTGGGAAATCCAAACCAATGCCGAATATGGTTCCCGTCTATGGGATGCG
CTCTGGCAGGCTGGTAAACCGCACGGGCTTATCGCCGCGGGCCGTAGCGCTATGAACGCCCTGCGGCTGGAGAAA
GGGATTCGGACATACGGAGTGGATATGACGACGGAGCATGATCCGCTCGAAGCGGGAGTTTTTCATCTAGTTGAT
TTGGACAAGAAGGAGGAGTATGTGGGCAAGGCCGCGATTCAGAGTGCTGCGCAGCGAAAGCAGCCTCCTTTGAGA
AGGCTGCGGTGCTTGACTATTGATGATGGACATTCTATGGTAATGGGGAAGGAGCCTGTATATTTTGGAGGGAGG
CCCGTCGGGTATGTCACTACTGCGGTGTTTAGCTATACAACAAAGAGGCCCGCTGCGTATGCGTGGCTGCCCGGG
AGGGTTCGTGAGGGGGATGCAGTTGTGATTGAGTATTTTGGAAGGCAAATTAAGGCAACGGTGTCGGCGGATCCG
TTGTTTGATCCACGGGGGAGCAAGTTGCATCGGGAGGATACGGGTGCAGATGGATTTGAGACGCCGTTGAAGAAT
CGCTTGTAA
Transcript >Ani_SJS100_1|g3569.t1
ATGGCAGCAACACAACGTGTGGTCATCATAGGAGCTGGAATCGTGGGCGCCAACCTCGCCGATGAACTGGTCACT
CGGGGATGGCAGGACATCACCGTCGTCGAGCAGGGCCCGTTGAACCTGCCGGGCGGCTCGACCTCGCACGCTCCC
GGGCTGGTCTTTCAAACCAACGGTTCGAAGACAATGACTCGTCTCGCACAATATACCGTTGACAAACTGCGATCG
CTAAGTGATGAGAATGGCATGCCGTGCTTCAATTCGATAGGAGGTCTGGAGGTGGCCACGACGCCGGCCCGAGTC
GAAGAGCTCAAGCGCAAGCTCGGCTATGCGATGTCCTGGGGTGTTGATGCGCGTCTTCTAACCAAGGAAGAGTGT
TTGGAGAAGTATCCTCTTCTGAACAAGGATCTCGTGCTAGCTGGTCTTCACACTCCGACCGATGGTCTCGCGTTA
GCTGCCCGCGCAACCCAGCTGCTTATCGCCCGGACCCAGCAGGCCGGGGTCCGCTACCGAGACTCGACGCTTGTT
ACAGGCATTGAACAAACAGGATCTCGTGTGACGGGCGTAAGAACCTCCCAGGGTATTATTCCCGCCGATATCGTC
ATCTCCTGCGCCGGCTTTTGGGGCGTCGAAATCGGAGCCATGGCTGGAGTCGCCATCCCTCTTCTACCACTTGCC
CATCAGTATGCGAAGACGACCACCGTGCCCGCTCTAGCGAATCGCGACGTCAACCACCGTCCGAACGGAATGAAT
GCGAGTATGCCCATCTTGCGGCATCAGGATCAGGATCTATACTACCGGGAGCATGGAGATCAGGTGGGGATTGGA
TACTATGGACACCGTCCAATGCCGGTGGTGGCTGCATCCTTGGGGCAGACTCCGGAACACGTTGATGAGAAGCAC
ATGCCCTCTCGACTCGAGTTCACGGCCCAGGACTTTGCGCCCGCCTGGAAGGCCTCGCAGGAACTGCTACCTGTT
CTCCGCGAGACCCAATTGGAGGACGGATTCAACGGCATCTTCTCGTTCACCCCAGACGGGGGGCCCCTCGTTGGA
CAAGCCTCTAACCTCGATGGTTTCTATGTAGCAGAAGCCGTCTGGGTCACCCACTCCGCCGGAGTCGCGCGAAGC
ATGGCGGAGCTGCTCACAGACGGAGCATCCACCATCGATCTCACGGAGTGCGAACTATCTCGCTTCGAGGAAGTA
CAGCTGAGCCGGGACTACGTCAACGAGACCTCGCAACAGAACTTCGTAGAGATCTACGACATCCTCCATCCCCTC
CAACCGAGAGAATCTCCCCGCCAGCTCCGAGTAAGCCCCTTCTACGAGAAACAACGAGCACTGGGCGCCTTCTTC
CTCGAACTCGGCGGCTGGGAGCGCCCATTCTGGTACGAAGCAAACGCACAGCTCCTGCACGCCCTCCCAGCACAA
TGGCAACCACCTCCCCGAGACACCTGGTCATCGCGATACACCTCCCCGATCACTGCCGTGGAAGCATGGAAGACC
CGCAATGCCGTCGCCATGTACGACCTAACCTCCTTCCACCGCGTACAAGTATCCGGACCCGGCGCAGCCACCCTC
CTGCAGCGCCTCACCACAAGCGACATCACCGCCCCTCCCGGCGCCATCACACACACCCTCCTCCTCAACAGACAG
GGCAAAATCCGCAGCGACATCTTCGTCGCTCGTCTGGAACCCGACCTCTTCCAAATCGGCGCCAACACCGCAACC
GATGTCGCCTACTTAGCCGTCGAAGCACGTCGCCAGAGACAACACACCCCGACCCAATGGGTCCAGGTATCCGAC
ATCACCGGCAGCACTTGCTGCATCGGCCTCTGGGGCCCTCGCTCACGGGCCGTGATCCGCGCCGTTTCCAACGAC
GACTTCTCCACCGCCGCTCTACCCTACATGTCCGTCAAACGTGCCACGATAGCCGGGATCCCCATTACCGCGCTC
CGCAAATCCTACGTCGGTGAACTCGGCTGGGAAATCCAAACCAATGCCGAATATGGTTCCCGTCTATGGGATGCG
CTCTGGCAGGCTGGTAAACCGCACGGGCTTATCGCCGCGGGCCGTAGCGCTATGAACGCCCTGCGGCTGGAGAAA
GGGATTCGGACATACGGAGTGGATATGACGACGGAGCATGATCCGCTCGAAGCGGGAGTTTTTCATCTAGTTGAT
TTGGACAAGAAGGAGGAGTATGTGGGCAAGGCCGCGATTCAGAGTGCTGCGCAGCGAAAGCAGCCTCCTTTGAGA
AGGCTGCGGTGCTTGACTATTGATGATGGACATTCTATGGTAATGGGGAAGGAGCCTGTATATTTTGGAGGGAGG
CCCGTCGGGTATGTCACTACTGCGGTGTTTAGCTATACAACAAAGAGGCCCGCTGCGTATGCGTGGCTGCCCGGG
AGGGTTCGTGAGGGGGATGCAGTTGTGATTGAGTATTTTGGAAGGCAAATTAAGGCAACGGTGTCGGCGGATCCG
TTGTTTGATCCACGGGGGAGCAAGTTGCATCGGGAGGATACGGGTGCAGATGGATTTGAGACGCCGTTGAAGAAT
CGCTTGTAA
Gene >Ani_SJS100_1|g3569.t1
ATGGCAGCAACACAACGTGTGGTCATCATAGGAGCTGGAATCGTGGGCGCCAACCTCGCCGATGAACTGGTCACT
CGGGGATGGCAGGACATCACCGTCGTCGAGCAGGGCCCGTTGAACCTGCCGGGCGGCTCGACCTCGCACGCTCCC
GGGCTGGTCTTTCAAACCAACGGTTCGAAGACAATGACTCGTCTCGCACAATATACCGTTGACAAACTGCGATCG
CTAAGTGATGAGAATGGCATGCCGTGCTTCAATTCGATAGGAGGTCTGGAGGTGGCCACGACGCCGGCCCGAGTC
GAAGAGCTCAAGCGCAAGCTCGGCTATGCGATGTCCTGGGGTGTTGATGCGCGTCTTCTAACCAAGGAAGAGTGT
TTGGAGAAGTATCCTCTTCTGAACAAGGATCTCGTGCTAGCTGGTCTTCACACTCCGACCGATGGTCTCGCGTTA
GCTGCCCGCGCAACCCAGCTGCTTATCGCCCGGACCCAGCAGGCCGGGGTCCGCTACCGAGACTCGACGCTTGTT
ACAGGCATTGAACAAACAGGATCTCGTGTGACGGGCGTAAGAACCTCCCAGGGTATTATTCCCGCCGATATCGTC
ATCTCCTGCGCCGGCTTTTGGGGCGTCGAAATCGGAGCCATGGCTGGAGTCGCCATCCCTCTTCTACCACTTGCC
CATCAGTATGCGAAGACGACCACCGTGCCCGCTCTAGCGAATCGCGACGTCAACCACCGTCCGAACGGAATGAAT
GCGAGTATGCCCATCTTGCGGCATCAGGATCAGGATCTATACTACCGGGAGCATGGAGATCAGGTGGGGATTGGA
TACTATGGACACCGTCCAATGCCGGTGGTGGCTGCATCCTTGGGGCAGACTCCGGAACACGTTGATGAGAAGCAC
ATGCCCTCTCGACTCGAGTTCACGGCCCAGGACTTTGCGCCCGCCTGGAAGGCCTCGCAGGAACTGCTACCTGTT
CTCCGCGAGACCCAATTGGAGGACGGATTCAACGGCATCTTCTCGTTCACCCCAGACGGGGGGCCCCTCGTTGGA
CAAGCCTCTAACCTCGATGGTTTCTATGTAGCAGAAGCCGTCTGGGTCACCCACTCCGCCGGAGTCGCGCGAAGC
ATGGCGGAGCTGCTCACAGACGGAGCATCCACCATCGATCTCACGGAGTGCGAACTATCTCGCTTCGAGGAAGTA
CAGCTGAGCCGGGACTACGTCAACGAGACCTCGCAACAGAACTTCGTAGAGATCTACGACATCCTCCATCCCCTC
CAACCGAGAGAATCTCCCCGCCAGCTCCGAGTAAGCCCCTTCTACGAGAAACAACGAGCACTGGGCGCCTTCTTC
CTCGAACTCGGCGGCTGGGAGCGCCCATTCTGGTACGAAGCAAACGCACAGCTCCTGCACGCCCTCCCAGCACAA
TGGCAACCACCTCCCCGAGACACCTGGTCATCGCGATACACCTCCCCGATCACTGCCGTGGAAGCATGGAAGACC
CGCAATGCCGTCGCCATGTACGACCTAACCTCCTTCCACCGCGTACAAGTATCCGGACCCGGCGCAGCCACCCTC
CTGCAGCGCCTCACCACAAGCGACATCACCGCCCCTCCCGGCGCCATCACACACACCCTCCTCCTCAACAGACAG
GGCAAAATCCGCAGCGACATCTTCGTCGCTCGTCTGGAACCCGACCTCTTCCAAATCGGCGCCAACACCGCAACC
GATGTCGCCTACTTAGCCGTCGAAGCACGTCGCCAGAGACAACACACCCCGACCCAATGGGTCCAGGTATCCGAC
ATCACCGGCAGCACTTGCTGCATCGGCCTCTGGGGCCCTCGCTCACGGGCCGTGATCCGCGCCGTTTCCAACGAC
GACTTCTCCACCGCCGCTCTACCCTACATGTCCGTCAAACGTGCCACGATAGCCGGGATCCCCATTACCGCGCTC
CGCAAATCCTACGTCGGTGAACTCGGCTGGGAAATCCAAACCAATGCCGAATATGGTTCCCGTCTATGGGATGCG
CTCTGGCAGGCTGGTAAACCGCACGGGCTTATCGCCGCGGGCCGTAGCGCTATGAACGCCCTGCGGCTGGAGAAA
GGGATTCGGACATACGGAGTGGATATGACGACGGAGCATGATCCGCTCGAAGCGGGAGTTTTTCATCTAGTTGAT
TTGGACAAGAAGGAGGAGTATGTGGGCAAGGCCGCGATTCAGAGTGCTGCGCAGCGAAAGCAGCCTCCTTTGAGA
AGGCTGCGGTGCTTGACTATTGATGATGGACATTCTATGGTAATGGGGAAGGAGCCTGTATATTTTGGAGGGAGG
CCCGTCGGGTATGTCACTACTGCGGTGTTTAGCTATACAACAAAGAGGCCCGCTGCGTATGCGTGGCTGCCCGGG
AGGGTTCGTGAGGGGGATGCAGTTGTGATTGAGTATTTTGGAAGGCAAATTAAGGCAACGGTGTCGGCGGATCCG
TTGTTTGATCCACGGGGGAGCAAGTTGCATCGGGAGGATACGGGTGCAGATGGATTTGAGACGCCGTTGAAGAAT
CGCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail