Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS100_1|g3535.t1
Gene name
Locationscaffold_016:224195..226217
Strand-
Gene length (bp)2022
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.6E-27 402 519
PF00072 Response_reg Response regulator receiver domain 7.5E-22 555 666
PF00989 PAS PAS fold 2.1E-11 172 270
PF08448 PAS_4 PAS fold 1.5E-07 172 276
PF00512 HisKA His Kinase A (phospho-acceptor) domain 4.4E-13 292 356
PF13426 PAS_9 PAS domain 3.2E-08 172 273

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0007165 signal transduction Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0016740 transferase activity No
GO:0009987 cellular process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0065007 biological regulation No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0004673 protein histidine kinase activity No
GO:0031323 regulation of cellular metabolic process No
GO:0140299 small molecule sensor activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0051252 regulation of RNA metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0019222 regulation of metabolic process No
GO:0004672 protein kinase activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0016301 kinase activity No
GO:0035556 intracellular signal transduction No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0009889 regulation of biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS100_1|g3535.t1
MFLDGHLAALSLEEKSATTHSVRVPDDDSPAVSPSLACIYRHTPTPTIVLDSSMTIVEVSDSHLALSGKTRQSML
HATVRDLDPAAVPAPNIAILCGALRAACSTKEIQIVERIVSSDKSLYNLRVTPIFNDFTLLYIVLEAHKLSVETA
SINHAYTNETYKILVDTVKEYAIFMLDTQGNITTWNPGAAIMKGWPAEEILGRHFSVFYSPEDRLAGKPLRGLAV
CLREGRMEDEGWRYRRDGSRFWANVLITPIYQFGQHVGFVKVTRDLSERKEAEARIIAAFEESSRLKTDFLANIS
HEIRTPMNGMKLAMTMLADTGLSATQLEHAAIIQDSMSLLLETVNDVLDYSKLSSGSFSLHSDVVDVNDVVGAVI
RNCRPSLKNGVELTTDIAPDFPRNLRGDPLRYRQILQNLVGNAVKFTESGHIRVSTVCSPDEQEEGCCLVRTEVI
DTGIGVPDNAMNTLFTPFTRFANSSTRQYQGTGLGLSICKSLAELMDGEVGYSPNPEGRGSVFWFTAKLGERSIT
TSLKPRSPVLTPVGDDLCDKMRAIAPHKHVLLVEDNMVNHTMMLKLLRSIGFTRVDGAWNGAEALSKIKKKPLSY
NVVLMDVSMPIMDGLVATGHIRDMGLQMPIIAVTGNAMQGDAESYIAKGMSDCIGKPVHRDQLLSILWKWIGS*
Coding >Ani_SJS100_1|g3535.t1
ATGTTCCTCGACGGCCATTTGGCCGCTCTTTCCCTCGAGGAGAAGTCCGCGACAACACACAGTGTACGTGTGCCC
GACGATGACTCCCCAGCGGTGTCTCCCTCTCTGGCATGCATCTATCGCCATACTCCGACTCCCACGATCGTCCTC
GATTCATCTATGACCATCGTCGAGGTCTCTGATAGTCATCTCGCTTTATCCGGCAAGACGCGCCAATCCATGCTG
CATGCGACCGTTCGTGATCTCGACCCTGCTGCCGTACCCGCCCCTAATATCGCTATCCTCTGTGGCGCATTGCGT
GCAGCCTGCTCGACGAAGGAAATTCAGATAGTCGAGAGAATTGTGTCTAGCGATAAATCTTTGTACAACCTCCGA
GTTACTCCGATTTTCAACGACTTTACCCTGCTTTACATTGTGTTGGAGGCGCACAAGCTATCGGTGGAGACCGCC
AGCATTAACCATGCCTATACGAACGAAACCTACAAGATCCTCGTGGATACTGTCAAAGAGTACGCCATTTTCATG
CTGGATACACAGGGCAATATCACCACCTGGAACCCGGGCGCTGCCATCATGAAGGGATGGCCAGCAGAGGAGATC
CTTGGCAGACATTTCTCTGTCTTTTACAGCCCGGAGGATCGCCTGGCAGGAAAGCCTCTAAGAGGTCTTGCTGTG
TGCTTGCGAGAAGGCCGTATGGAGGATGAGGGGTGGAGGTATCGGCGCGATGGCTCGCGGTTTTGGGCCAACGTA
CTTATCACCCCCATCTACCAGTTTGGACAGCATGTTGGTTTTGTTAAAGTGACCCGAGATCTCAGCGAGCGCAAA
GAAGCAGAGGCGCGCATAATTGCTGCCTTCGAAGAGTCATCACGCCTCAAAACAGACTTTCTCGCTAATATTAGC
CATGAAATTCGAACTCCGATGAATGGGATGAAACTTGCCATGACCATGCTGGCCGACACAGGTCTGTCTGCGACA
CAGCTCGAGCATGCCGCAATCATCCAAGACTCTATGTCACTCTTACTTGAGACTGTGAACGATGTTCTCGACTAC
TCGAAACTTTCATCTGGCTCTTTCTCGTTACATTCCGACGTCGTCGATGTCAACGATGTGGTCGGAGCGGTCATA
CGAAATTGTCGCCCCTCATTGAAGAACGGGGTGGAACTGACTACGGACATTGCACCCGACTTTCCCAGGAATCTT
CGAGGAGATCCCCTACGATATCGCCAGATTCTGCAGAATTTGGTCGGCAATGCCGTCAAGTTTACCGAGAGCGGC
CATATTCGGGTCTCCACAGTGTGTTCTCCGGATGAACAAGAGGAGGGCTGCTGCCTAGTGCGTACAGAGGTCATA
GACACCGGCATTGGCGTTCCTGACAATGCAATGAATACCCTATTCACCCCGTTCACACGCTTTGCCAACTCGAGC
ACTCGACAATACCAGGGGACTGGATTAGGCCTTTCCATTTGCAAAAGCCTGGCCGAACTCATGGACGGAGAAGTG
GGATATTCGCCAAATCCCGAAGGCCGAGGCAGTGTCTTCTGGTTTACTGCCAAATTAGGAGAACGATCCATTACT
ACGTCGCTAAAGCCCCGCAGTCCTGTATTAACACCCGTGGGTGATGATCTCTGCGATAAAATGCGGGCCATTGCA
CCCCACAAACATGTCTTGTTGGTTGAGGACAACATGGTCAACCATACCATGATGCTGAAACTTCTTCGCAGCATC
GGCTTCACGCGAGTGGATGGGGCCTGGAATGGTGCTGAGGCACTTTCCAAGATAAAGAAGAAGCCGTTATCGTAC
AACGTCGTTTTGATGGATGTCTCCATGCCCATCATGGACGGCCTTGTCGCCACCGGGCATATCCGCGACATGGGG
TTACAAATGCCGATTATCGCAGTCACGGGTAATGCTATGCAGGGCGATGCCGAAAGCTACATTGCCAAGGGCATG
AGCGATTGCATCGGTAAGCCGGTTCACCGAGATCAACTACTGAGTATTTTATGGAAGTGGATTGGATCTTGA
Transcript >Ani_SJS100_1|g3535.t1
ATGTTCCTCGACGGCCATTTGGCCGCTCTTTCCCTCGAGGAGAAGTCCGCGACAACACACAGTGTACGTGTGCCC
GACGATGACTCCCCAGCGGTGTCTCCCTCTCTGGCATGCATCTATCGCCATACTCCGACTCCCACGATCGTCCTC
GATTCATCTATGACCATCGTCGAGGTCTCTGATAGTCATCTCGCTTTATCCGGCAAGACGCGCCAATCCATGCTG
CATGCGACCGTTCGTGATCTCGACCCTGCTGCCGTACCCGCCCCTAATATCGCTATCCTCTGTGGCGCATTGCGT
GCAGCCTGCTCGACGAAGGAAATTCAGATAGTCGAGAGAATTGTGTCTAGCGATAAATCTTTGTACAACCTCCGA
GTTACTCCGATTTTCAACGACTTTACCCTGCTTTACATTGTGTTGGAGGCGCACAAGCTATCGGTGGAGACCGCC
AGCATTAACCATGCCTATACGAACGAAACCTACAAGATCCTCGTGGATACTGTCAAAGAGTACGCCATTTTCATG
CTGGATACACAGGGCAATATCACCACCTGGAACCCGGGCGCTGCCATCATGAAGGGATGGCCAGCAGAGGAGATC
CTTGGCAGACATTTCTCTGTCTTTTACAGCCCGGAGGATCGCCTGGCAGGAAAGCCTCTAAGAGGTCTTGCTGTG
TGCTTGCGAGAAGGCCGTATGGAGGATGAGGGGTGGAGGTATCGGCGCGATGGCTCGCGGTTTTGGGCCAACGTA
CTTATCACCCCCATCTACCAGTTTGGACAGCATGTTGGTTTTGTTAAAGTGACCCGAGATCTCAGCGAGCGCAAA
GAAGCAGAGGCGCGCATAATTGCTGCCTTCGAAGAGTCATCACGCCTCAAAACAGACTTTCTCGCTAATATTAGC
CATGAAATTCGAACTCCGATGAATGGGATGAAACTTGCCATGACCATGCTGGCCGACACAGGTCTGTCTGCGACA
CAGCTCGAGCATGCCGCAATCATCCAAGACTCTATGTCACTCTTACTTGAGACTGTGAACGATGTTCTCGACTAC
TCGAAACTTTCATCTGGCTCTTTCTCGTTACATTCCGACGTCGTCGATGTCAACGATGTGGTCGGAGCGGTCATA
CGAAATTGTCGCCCCTCATTGAAGAACGGGGTGGAACTGACTACGGACATTGCACCCGACTTTCCCAGGAATCTT
CGAGGAGATCCCCTACGATATCGCCAGATTCTGCAGAATTTGGTCGGCAATGCCGTCAAGTTTACCGAGAGCGGC
CATATTCGGGTCTCCACAGTGTGTTCTCCGGATGAACAAGAGGAGGGCTGCTGCCTAGTGCGTACAGAGGTCATA
GACACCGGCATTGGCGTTCCTGACAATGCAATGAATACCCTATTCACCCCGTTCACACGCTTTGCCAACTCGAGC
ACTCGACAATACCAGGGGACTGGATTAGGCCTTTCCATTTGCAAAAGCCTGGCCGAACTCATGGACGGAGAAGTG
GGATATTCGCCAAATCCCGAAGGCCGAGGCAGTGTCTTCTGGTTTACTGCCAAATTAGGAGAACGATCCATTACT
ACGTCGCTAAAGCCCCGCAGTCCTGTATTAACACCCGTGGGTGATGATCTCTGCGATAAAATGCGGGCCATTGCA
CCCCACAAACATGTCTTGTTGGTTGAGGACAACATGGTCAACCATACCATGATGCTGAAACTTCTTCGCAGCATC
GGCTTCACGCGAGTGGATGGGGCCTGGAATGGTGCTGAGGCACTTTCCAAGATAAAGAAGAAGCCGTTATCGTAC
AACGTCGTTTTGATGGATGTCTCCATGCCCATCATGGACGGCCTTGTCGCCACCGGGCATATCCGCGACATGGGG
TTACAAATGCCGATTATCGCAGTCACGGGTAATGCTATGCAGGGCGATGCCGAAAGCTACATTGCCAAGGGCATG
AGCGATTGCATCGGTAAGCCGGTTCACCGAGATCAACTACTGAGTATTTTATGGAAGTGGATTGGATCTTGA
Gene >Ani_SJS100_1|g3535.t1
ATGTTCCTCGACGGCCATTTGGCCGCTCTTTCCCTCGAGGAGAAGTCCGCGACAACACACAGTGTACGTGTGCCC
GACGATGACTCCCCAGCGGTGTCTCCCTCTCTGGCATGCATCTATCGCCATACTCCGACTCCCACGATCGTCCTC
GATTCATCTATGACCATCGTCGAGGTCTCTGATAGTCATCTCGCTTTATCCGGCAAGACGCGCCAATCCATGCTG
CATGCGACCGTTCGTGATCTCGACCCTGCTGCCGTACCCGCCCCTAATATCGCTATCCTCTGTGGCGCATTGCGT
GCAGCCTGCTCGACGAAGGAAATTCAGATAGTCGAGAGAATTGTGTCTAGCGATAAATCTTTGTACAACCTCCGA
GTTACTCCGATTTTCAACGACTTTACCCTGCTTTACATTGTGTTGGAGGCGCACAAGCTATCGGTGGAGACCGCC
AGCATTAACCATGCCTATACGAACGAAACCTACAAGATCCTCGTGGATACTGTCAAAGAGTACGCCATTTTCATG
CTGGATACACAGGGCAATATCACCACCTGGAACCCGGGCGCTGCCATCATGAAGGGATGGCCAGCAGAGGAGATC
CTTGGCAGACATTTCTCTGTCTTTTACAGCCCGGAGGATCGCCTGGCAGGAAAGCCTCTAAGAGGTCTTGCTGTG
TGCTTGCGAGAAGGCCGTATGGAGGATGAGGGGTGGAGGTATCGGCGCGATGGCTCGCGGTTTTGGGCCAACGTA
CTTATCACCCCCATCTACCAGTTTGGACAGCATGTTGGTTTTGTTAAAGTGACCCGAGATCTCAGCGAGCGCAAA
GAAGCAGAGGCGCGCATAATTGCTGCCTTCGAAGAGTCATCACGCCTCAAAACAGACTTTCTCGCTAATATTAGC
CATGAAATTCGAACTCCGATGAATGGGATGAAACTTGCCATGACCATGCTGGCCGACACAGGTCTGTCTGCGACA
CAGCTCGAGCATGCCGCAATCATCCAAGACTCTATGTCACTCTTACTTGAGACTGTGAACGATGTTCTCGACTAC
TCGAAACTTTCATCTGGCTCTTTCTCGTTACATTCCGACGTCGTCGATGTCAACGATGTGGTCGGAGCGGTCATA
CGAAATTGTCGCCCCTCATTGAAGAACGGGGTGGAACTGACTACGGACATTGCACCCGACTTTCCCAGGAATCTT
CGAGGAGATCCCCTACGATATCGCCAGATTCTGCAGAATTTGGTCGGCAATGCCGTCAAGTTTACCGAGAGCGGC
CATATTCGGGTCTCCACAGTGTGTTCTCCGGATGAACAAGAGGAGGGCTGCTGCCTAGTGCGTACAGAGGTCATA
GACACCGGCATTGGCGTTCCTGACAATGCAATGAATACCCTATTCACCCCGTTCACACGCTTTGCCAACTCGAGC
ACTCGACAATACCAGGGGACTGGATTAGGCCTTTCCATTTGCAAAAGCCTGGCCGAACTCATGGACGGAGAAGTG
GGATATTCGCCAAATCCCGAAGGCCGAGGCAGTGTCTTCTGGTTTACTGCCAAATTAGGAGAACGATCCATTACT
ACGTCGCTAAAGCCCCGCAGTCCTGTATTAACACCCGTGGGTGATGATCTCTGCGATAAAATGCGGGCCATTGCA
CCCCACAAACATGTCTTGTTGGTTGAGGACAACATGGTCAACCATACCATGATGCTGAAACTTCTTCGCAGCATC
GGCTTCACGCGAGTGGATGGGGCCTGGAATGGTGCTGAGGCACTTTCCAAGATAAAGAAGAAGCCGTTATCGTAC
AACGTCGTTTTGATGGATGTCTCCATGCCCATCATGGACGGCCTTGTCGCCACCGGGCATATCCGCGACATGGGG
TTACAAATGCCGATTATCGCAGTCACGGGTAATGCTATGCAGGGCGATGCCGAAAGCTACATTGCCAAGGGCATG
AGCGATTGCATCGGTAAGCCGGTTCACCGAGATCAACTACTGAGTATTTTATGGAAGTGGATTGGATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail